TkA07G099600 | RubberDandelionOmics

Gene overview

TkA07G099600

Reference: TK1151 Chr: Chr07 Coordinates: 25993995-25994918 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · TkA07G099600|TK1151|cDNA

ATGAATCAACCAGCACTAAGATATATAATCCCAGCTTCAGAAGCTGAATCAATGGCGAAATCCAAAGGCCTAACCGTCCCTCAACTCCTCCCATCGCTCGTTAAATCCGCTCAAGATCTCGCTCGAACGCCCATTTCCAAATTCGACGTCGGTGTCGTTGGATTAAGCTCCGATGGCCGGATATTCTTTGGTGCCAACATCGAGTTCCCTGGTCTTCCCCTCCACCATTCCATCCACGCTGAACAGTTCCTTATCACCAA...

CDS

Download CDS FASTA

924 bp · TkA07G099600|TK1151|CDS

ATGAATCAACCAGCACTAAGATATATAATCCCAGCTTCAGAAGCTGAATCAATGGCGAAATCCAAAGGCCTAACCGTCCCTCAACTCCTCCCATCGCTCGTTAAATCCGCTCAAGATCTCGCTCGAACGCCCATTTCCAAATTCGACGTCGGTGTCGTTGGATTAAGCTCCGATGGCCGGATATTCTTTGGTGCCAACATCGAGTTCCCTGGTCTTCCCCTCCACCATTCCATCCACGCTGAACAGTTCCTTATCACCAA...

Protein

Download Protein FASTA

307 aa · TkA07G099600|TK1151|PROTEIN

MNQPALRYIIPASEAESMAKSKGLTVPQLLPSLVKSAQDLARTPISKFDVGVVGLSSDGRIFFGANIEFPGLPLHHSIHAEQFLITNLAAHGGGPKLLNIAVSAAPCGHCRQFLQEIRGVSETQIVVTDQPLQNPDYKSISSILPNPFGPFDLLDQKTPLVLEKHSNKLSLKDDDSSITQNGNSWNLSNGYQELIDKKEKSLVTEALEAARGSHAPYSGCPSGVALMDCEGKVYKGSYMESAAYNPSMMPVQAALVAYMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G099600`
TK1151 ID	TkA07G099600
OH-1004 ID	LXL04_027879
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G099600

Location Chr07:25993995-25994918 (-)

Description Similar to CDA1: Cytidine deaminase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19570`	This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.	Cloning, expression, and purification of cytidine deaminase from Arabidopsis thaliana.1999 · DOI: 10.1006/prep.1998.0959
`At4g29610`	This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.	No verified direct reference in this release
`At4g29600`	This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.	No verified direct reference in this release
`At4g29620`	This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.	No verified direct reference in this release
`At4g29570`	This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027879 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006216 cytidine catabolic process Biological Process

GO:0046135 pyrimidine nucleoside catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004126 cytidine deaminase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G19570

ath:AT4G29600

ath:AT4G29610

ath:AT4G29620

ath:AT4G29640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.677

Rank 1 · TkA07G099600 · TK1151

Nucleus0.393

Rank 2 · TkA07G099600 · TK1151

Peroxisome0.094

Rank 3 · TkA07G099600 · TK1151

Mitochondrion0.093

Rank 4 · TkA07G099600 · TK1151

Cell membrane0.057

Rank 5 · TkA07G099600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00383dCMP_cyt_deam_133-121 aa

PF08211dCMP_cyt_deam_242-68 aa

PF26947CDL57-75 aa

PF14441OTT_1508_deam78-118 aa

PF08211dCMP_cyt_deam_2141-288 aa

PF00383dCMP_cyt_deam_1198-261 aa

PF26947CDL210-284 aa

PF00383dCMP_cyt_deam_1268-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G099600	`PF00383`	dCMP_cyt_deam_1	33	121	2.3e-17	63.5
TkA07G099600	`PF08211`	dCMP_cyt_deam_2	42	68	1.8e-46	158.3
TkA07G099600	`PF26947`	CDL	57	75	0.011	16.7
TkA07G099600	`PF14441`	OTT_1508_deam	78	118	0.03	15.0
TkA07G099600	`PF08211`	dCMP_cyt_deam_2	141	288	1.8e-46	158.3
TkA07G099600	`PF00383`	dCMP_cyt_deam_1	198	261	2.3e-17	63.5
TkA07G099600	`PF26947`	CDL	210	284	0.011	16.7
TkA07G099600	`PF00383`	dCMP_cyt_deam_1	268	282	2.3e-17	63.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65896`	Arabidopsis thaliana	sp\|O65896\|CDA1_ARATH Cytidine deaminase 1	57.400%	Swiss-Prot	High
`Q9SU86`	Arabidopsis thaliana	sp\|Q9SU86\|CDA6_ARATH Cytidine deaminase 6	45.500%	Swiss-Prot	Medium
`Q9SU87`	Arabidopsis thaliana	sp\|Q9SU87\|CDA7_ARATH Cytidine deaminase 7	42.800%	Swiss-Prot	Medium
`O65571`	Arabidopsis thaliana	sp\|O65571\|CDA2_ARATH Cytidine deaminase 2	40.000%	Swiss-Prot	Medium
`Q9XEX4`	Arabidopsis thaliana	sp\|Q9XEX4\|CDA8_ARATH Cytidine deaminase 8	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card