TkA07G099540 | RubberDandelionOmics

Gene overview

TkA07G099540

Reference: TK1151 Chr: Chr07 Coordinates: 25966445-25967905 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · TkA07G099540|TK1151|cDNA

ATGGGGATAGATGCTGTAAAACCCTCACCGGTGCCGATCAAGGAAGAAAACTCATCGAACATCTCCACCGCAACCACCGCGGCAGAACCCTCCACCACCACCGTCCTCCTCTTCTCCCTACTCCTCAGCACCTGCATCGCTCTATCCACCAACCACCACCACACTTCCACCGCTATCCAAATCGCCCGTCCACTCACTAAACTCACTCACCCAGTCGTCATCCTCATTTCCTCAGATGGATTCCGATTTGGGTACCAATT...

CDS

Download CDS FASTA

1383 bp · TkA07G099540|TK1151|CDS

ATGGGGATAGATGCTGTAAAACCCTCACCGGTGCCGATCAAGGAAGAAAACTCATCGAACATCTCCACCGCAACCACCGCGGCAGAACCCTCCACCACCACCGTCCTCCTCTTCTCCCTACTCCTCAGCACCTGCATCGCTCTATCCACCAACCACCACCACACTTCCACCGCTATCCAAATCGCCCGTCCACTCACTAAACTCACTCACCCAGTCGTCATCCTCATTTCCTCAGATGGATTCCGATTTGGGTACCAATT...

Protein

Download Protein FASTA

460 aa · TkA07G099540|TK1151|PROTEIN

MGIDAVKPSPVPIKEENSSNISTATTAAEPSTTTVLLFSLLLSTCIALSTNHHHTSTAIQIARPLTKLTHPVVILISSDGFRFGYQFKTPTPNIHRLINNGTEAETGLIPVYPTLTFPNHYSIATGLYPAYHGIINNKFIDPIAGDSFTMASHESKWWLGEPIWETIANHGLKAATYFWPGSEVNKGLWDCPVNYCAPYNESVPFEERVDTVLNYFDLPNPDIPIFMTLYFEDPDHQGHQVGPDDPQITEAISHIDALIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G099540`
TK1151 ID	TkA07G099540
OH-1004 ID	LXL04_027876
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.000
Protein coverage (%)	TK1151 91.087 / OH-1004 91.189 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G099540`
Location	Chr07:25966445-25967905 (+)
Description	Similar to Venom phosphodiesterase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027876` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006220 pyrimidine nucleotide metabolic process Biological Process GO:0006796 phosphate-containing compound metabolic process Biological Process GO:0009143 nucleoside triphosphate catabolic process Biological Process GO:0046034 ATP metabolic process Biological Process GO:0055062 phosphate ion homeostasis Biological Process GO:0160049 negative regulation of cGAS/STING signaling pathway Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009897 external side of plasma membrane Cellular Component GO:0016324 apical plasma membrane Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component
KEGG gene cross-reference	hsa:5169 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.536

Rank 1 · TkA07G099540 · TK1151

Extracellular0.143

Rank 2 · TkA07G099540 · TK1151

Cytoplasm0.136

Rank 3 · TkA07G099540 · TK1151

Endoplasmic reticulum0.134

Rank 4 · TkA07G099540 · TK1151

Cell membrane0.115

Rank 5 · TkA07G099540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00884Sulfatase71-138 aa

PF01663Phosphodiest73-399 aa

PF09764Nt_Gln_amidase112-172 aa

PF00884Sulfatase214-284 aa

PF07394DUF1501248-284 aa

PF02995DUF229250-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G099540	`PF00884`	Sulfatase	71	138	2.8e-07	30.9
TkA07G099540	`PF01663`	Phosphodiest	73	399	1.1e-107	361.3
TkA07G099540	`PF09764`	Nt_Gln_amidase	112	172	0.21	11.9
TkA07G099540	`PF00884`	Sulfatase	214	284	2.8e-07	30.9
TkA07G099540	`PF07394`	DUF1501	248	284	0.27	11.1
TkA07G099540	`PF02995`	DUF229	250	285	0.053	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card