TkA07G094620 | RubberDandelionOmics

Gene overview

TkA07G094620

Reference: TK1151 Chr: Chr07 Coordinates: 24676456-24677266 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA07G094620|TK1151|cDNA

TCTAAAACCGAAAAAGAATATTAAGTTCTTAAAAAAAAGATGGGAAGAAGTCCATGTTGCTCAAAGATAGGTCTGAATAGAGGTTCATGGACAGCTTCTGAAGACAAGATTCTTAGTGACTATGTCAAGCTTCATGGTGAAGGCAAATGGAGACAACTTCCCATCAAAGCAGGTTTGAAGAGATGTGGAAAGAGTTGTAGGTTGAGATGGTTGAATTACTTAAAACCCGACATAAAAAGAGGCAACATTTCTTCTGATGA...

CDS

Download CDS FASTA

393 bp · TkA07G094620|TK1151|CDS

ATGGGAAGAAGTCCATGTTGCTCAAAGATAGGTCTGAATAGAGGTTCATGGACAGCTTCTGAAGACAAGATTCTTAGTGACTATGTCAAGCTTCATGGTGAAGGCAAATGGAGACAACTTCCCATCAAAGCAGGTTTGAAGAGATGTGGAAAGAGTTGTAGGTTGAGATGGTTGAATTACTTAAAACCCGACATAAAAAGAGGCAACATTTCTTCTGATGAAGAAGATCTCATCATCCGGCTTCATAAACTGTTGGGAAA...

Protein

Download Protein FASTA

130 aa · TkA07G094620|TK1151|PROTEIN

MGRSPCCSKIGLNRGSWTASEDKILSDYVKLHGEGKWRQLPIKAGLKRCGKSCRLRWLNYLKPDIKRGNISSDEEDLIIRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNTTLAKKVRVLKNMLKGTKRSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G094620`
TK1151 ID	TkA07G094620
OH-1004 ID	LXL04_027801
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.231 / OH-1004 45.850 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G094620

Location Chr07:24676456-24677266 (-)

Description Similar to MYB1: Transcription factor MYB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22640`	Transcription factor MYB3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010224 response to UV-B Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031542 positive regulation of anthocyanin biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:1900386 positive regulation of flavonol biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT5G49330

zma:541757

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.932

Rank 1 · TkA07G094620 · TK1151

Cytoplasm0.126

Rank 2 · TkA07G094620 · TK1151

Mitochondrion0.024

Rank 3 · TkA07G094620 · TK1151

Cell membrane0.013

Rank 4 · TkA07G094620 · TK1151

Plastid0.008

Rank 5 · TkA07G094620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-75 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_671-116 aa

PF15963Myb_DNA-bind_772-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G094620	`PF00249`	Myb_DNA-binding	14	61	1.2e-34	118.9
TkA07G094620	`PF13921`	Myb_DNA-bind_6	17	75	1e-19	71.2
TkA07G094620	`PF00249`	Myb_DNA-binding	67	112	1.2e-34	118.9
TkA07G094620	`PF13921`	Myb_DNA-bind_6	71	116	1e-19	71.2
TkA07G094620	`PF15963`	Myb_DNA-bind_7	72	127	0.08	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9K9`	Arabidopsis thaliana	sp\|Q9S9K9\|MYB3_ARATH Transcription factor MYB3	69.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card