TkA07G092670 | RubberDandelionOmics

Gene overview

TkA07G092670

Reference: TK1151 Chr: Chr07 Coordinates: 24136157-24137279 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

513 bp · TkA07G092670|TK1151|cDNA

ATGCTGAACAGAATTAACAGTAGACTTTATCGCCCTTCAATAAGTTCCACATGCTCAGTGGTTAAAAGACGGGCAATGTTTAAGCTTAAACAAGCACAAGATAGAAATCATATTGTTGAGGGCATCTTAATTGGGCTTGATAATATCGATGATGTGATTGATGTAATAAGAAAAGCTACAAGCAACTCAGTGGCATCAACTGATTTGAGGAAAACTGAAGCCATATTAGATATCAACTTACGAAGACTTACAATGCTTGA...

CDS

Download CDS FASTA

513 bp · TkA07G092670|TK1151|CDS

ATGCTGAACAGAATTAACAGTAGACTTTATCGCCCTTCAATAAGTTCCACATGCTCAGTGGTTAAAAGACGGGCAATGTTTAAGCTTAAACAAGCACAAGATAGAAATCATATTGTTGAGGGCATCTTAATTGGGCTTGATAATATCGATGATGTGATTGATGTAATAAGAAAAGCTACAAGCAACTCAGTGGCATCAACTGATTTGAGGAAAACTGAAGCCATATTAGATATCAACTTACGAAGACTTACAATGCTTGA...

Protein

Download Protein FASTA

170 aa · TkA07G092670|TK1151|PROTEIN

MLNRINSRLYRPSISSTCSVVKRRAMFKLKQAQDRNHIVEGILIGLDNIDDVIDVIRKATSNSVASTDLRKTEAILDINLRRLTMLERNKYVNEGKSLTKQISNLEELLSSRKQILQVIEQEANEIKNKFSTPRQSNKSKIQECLYDDMLIMFGWNHMNRDRIAGMESSE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G092670`
TK1151 ID	TkA07G092670
OH-1004 ID	LXL04_010268
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G092670

Location Chr07:24136157-24137279 (-)

Description Similar to GYRA: DNA gyrase subunit A, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10690`	A type II topoisomerase that negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner.	Arabidopsis thaliana DNA gyrase is targeted to chloroplasts and mitochondria.2004 · DOI: 10.1073/pnas.0400836101

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0812000`	A type II topoisomerase that negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010268 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006265 DNA topological change Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009330 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G10690

sep:SE_0005

ser:SERP2548

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.796

Rank 1 · TkA07G092670 · TK1151

Cytoplasm0.242

Rank 2 · TkA07G092670 · TK1151

Mitochondrion0.037

Rank 3 · TkA07G092670 · TK1151

Cell membrane0.021

Rank 4 · TkA07G092670 · TK1151

Lysosome / Vacuole0.012

Rank 5 · TkA07G092670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00521DNA_topoisoIV14-122 aa

PF29562DUF856736-84 aa

PF25014NET2A50-133 aa

PF03961FapA73-157 aa

PF29562DUF856782-133 aa

PF04871Uso1_p115_C90-154 aa

PF21293RNAseD_HRDC_C100-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G092670	`PF00521`	DNA_topoisoIV	14	122	1.5e-15	57.8
TkA07G092670	`PF29562`	DUF8567	36	84	0.029	14.9
TkA07G092670	`PF25014`	NET2A	50	133	0.059	13.9
TkA07G092670	`PF03961`	FapA	73	157	0.028	14.8
TkA07G092670	`PF29562`	DUF8567	82	133	0.029	14.9
TkA07G092670	`PF04871`	Uso1_p115_C	90	154	0.0064	17.5
TkA07G092670	`PF21293`	RNAseD_HRDC_C	100	122	0.082	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAF6`	Arabidopsis thaliana	sp\|Q9CAF6\|GYRA_ARATH DNA gyrase subunit A, chloroplastic/mitochondrial	55.700%	Swiss-Prot	High
`Q7XZF7`	Oryza sativa subsp. japonica	sp\|Q7XZF7\|GYRA_ORYSJ Probable DNA gyrase subunit A, chloroplastic/mitochondrial	50.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card