TkA07G091710 | RubberDandelionOmics

Gene overview

TkA07G091710

Reference: TK1151 Chr: Chr07 Coordinates: 23916456-23918418 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1460 bp · TkA07G091710|TK1151|cDNA

TCTCTCTCTCTCTCTCCAATAAACACATAAATATTGTCAAAGCATAAATAAAGACCCTTCACCCATAATTTGTCAAACTTTCCTTCTCCTCCTTCTTCTCTTCTATCTTGATCTCTCCCCCTCTTTGTCTATTCTGCTTGTTCATTTTCCACTTGTTCTTCTCCAGCTTCAGCCATGTCTGAAGACCAAAGAGACCTCTACTACCATGATCCATTCCATGATGATCAAAGAGCAAGTGATACTCTTTTTTCATTCTTCGG...

CDS

Download CDS FASTA

990 bp · TkA07G091710|TK1151|CDS

ATGTCTGAAGACCAAAGAGACCTCTACTACCATGATCCATTCCATGATGATCAAAGAGCAAGTGATACTCTTTTTTCATTCTTCGGCCCCAATTCAACCATTAGAGACGATTCATCACCACCAAATCATCAAAGATTTCATGACTACATGGGGTTATCTAACTTCTTCACTGGATCTAATGGTTATAACACATCTGCAACAACGTTTGGTTACTCATCTTCTTCATCACAACAGGTTTTTTCCCTTCAAGATGACCAAAA...

Protein

Download Protein FASTA

329 aa · TkA07G091710|TK1151|PROTEIN

MSEDQRDLYYHDPFHDDQRASDTLFSFFGPNSTIRDDSSPPNHQRFHDYMGLSNFFTGSNGYNTSATTFGYSSSSSQQVFSLQDDQNPMRVPGNLVGVTEMTPVTPNSSSVLSSSTEAADDDHELNEGKKENQPKSVPEDVEDSKKATKQKKKDEKKQREPRFAFMTKSDIDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSYQDPTTVITTYEGQHNHHLPATLRGNVGGLLYPPSMMAAQGAMMGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G091710`
TK1151 ID	TkA07G091710
OH-1004 ID	LXL04_027761
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G091710

Location Chr07:23916456-23918418 (-)

Description Similar to WRKY28: WRKY transcription factor 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18170`	Transcription factor.	No verified direct reference in this release
`At1g29860`	Transcription factor.	No verified direct reference in this release
`At5g46350`	Transcription factor.	Wounding-induced WRKY8 is involved in basal defense in Arabidopsis.2010 · DOI: 10.1094/mpmi-23-5-0558 Arabidopsis transcription factor WRKY8 functions antagonistically with its interacting partner VQ9 to modulate salinity stress tolerance.2013 · DOI: 10.1111/tpj.12159 WRKY8 transcription factor functions in the TMV-cg defense response by mediating both abscisic acid and ethylene signaling in Arabidopsis.2013 · DOI: 10.1073/pnas.1221347110
`At2g47260`	Transcription factor.	No verified direct reference in this release
`At5g49520`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027761 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009624 response to nematode Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G29860

ath:AT2G47260

ath:AT4G18170

ath:AT5G46350

ath:AT5G49520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · TkA07G091710 · TK1151

Cytoplasm0.085

Rank 2 · TkA07G091710 · TK1151

Cell membrane0.023

Rank 3 · TkA07G091710 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA07G091710 · TK1151

Plastid0.009

Rank 5 · TkA07G091710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04406TP6A_N5-24 aa

PF01805Surp155-189 aa

PF03106WRKY175-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G091710	`PF04406`	TP6A_N	5	24	0.34	11.5
TkA07G091710	`PF01805`	Surp	155	189	0.12	12.7
TkA07G091710	`PF03106`	WRKY	175	232	4.7e-26	91.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWJ2`	Arabidopsis thaliana	sp\|Q8VWJ2\|WRK28_ARATH WRKY transcription factor 28	43.100%	Swiss-Prot	Medium
`Q93WV4`	Arabidopsis thaliana	sp\|Q93WV4\|WRK71_ARATH WRKY transcription factor 71	54.500%	Swiss-Prot	Medium
`Q9FL26`	Arabidopsis thaliana	sp\|Q9FL26\|WRKY8_ARATH WRKY transcription factor 8	51.100%	Swiss-Prot	Medium
`O22900`	Arabidopsis thaliana	sp\|O22900\|WRK23_ARATH WRKY transcription factor 23	49.200%	Swiss-Prot	Medium
`Q9FGZ4`	Arabidopsis thaliana	sp\|Q9FGZ4\|WRK48_ARATH Probable WRKY transcription factor 48	47.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card