RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G088300
Reference: TK1151 Chr: Chr07 Coordinates: 23039863-23042527 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1916 bp · TkA07G088300|TK1151|cDNA

GTGGATACTGTAACAAGTCATATGCTCATATTAACCCGATTTAGACACGCTTAATCATCGATTAAATATATAAACCAAAGTATATTCTAAAGACAACTTTGAATTATTGATTGTCCAAATCTTATCGTTAAAAAGAAATGTATTTTAAGTTTTTAAAAAAGAAACAAAAAAAAAACAAACACACCATAGCCCATGGCACCTGCAGAACCCCACGATCCTCAAAGACCACACTAGACAAATTGAAAATCGATTCTCGAAAA...

CDS

Download CDS FASTA

1143 bp · TkA07G088300|TK1151|CDS

ATGTATTTTAAGTTTTTAAAAAAGAAACAAAAAAAAAACAAACACACCATAGCCCATGGCACCTGCAGAACCCCACGATCCTCAAAGACCACACTAGACAAATTGAAAATCGATTCTCGAAAATCTTACATGGCTTCTCCAACCACCACCACCGCAACCGCAACCGCAACCGCAACCACCTCCTTCATGGAACGCCTGACCTACCGCTGCCATTGTTGCAACTGCGACGTCTCCCCTTCGCCATCCTCTTCCTCCTCCTC...

Protein

Download Protein FASTA

380 aa · TkA07G088300|TK1151|PROTEIN

MYFKFLKKKQKKNKHTIAHGTCRTPRSSKTTLDKLKIDSRKSYMASPTTTTATATATATTSFMERLTYRCHCCNCDVSPSPSSSSSSSAIATSISLLCPNCNCDCLEQVISNNNPNPNYPNQLSSQLSFPSFDPSIPTTTADSARTFPFPSVTASDDNFLLDSPYLHRLINHLTNSSDSSPSTTTITTSLRQSPTSKSAIEAIPMIKITSAFLDIDPIVLCAVCKDQFVIDDETKQLPCKHMYHPDCILPWLSQHNSCPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G088300
TK1151 IDTkA07G088300
OH-1004 IDLXL04_035544
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)60.200
Protein coverage (%)TK1151 23.158 / OH-1004 23.380
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G088300
LocationChr07:23039863-23042527 (+)
DescriptionSimilar to RING1: E3 ubiquitin-protein ligase RING1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g39720 Probable E3 ubiquitin-protein ligase that may possess E3 ubiquitin ligase activity in vitro. No verified direct reference in this release
At3g19950 E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. No verified direct reference in this release
At3g56580 E3 ubiquitin-protein ligase that promotes osmotic stress and abscisic acid (ABA) responses.
The atrzf1 mutation of the novel RING-type E3 ubiquitin ligase increases proline contents and enhances drought tolerance in Arabidopsis.2013 · DOI: 10.1016/j.plantsci.2012.12.007
PCA22 acts as a suppressor of atrzf1 to mediate proline accumulation in response to abiotic stress in Arabidopsis.2017 · DOI: 10.1093/jxb/erx069
At5g59550 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid-dependent drought stress responses.
Suppression of Arabidopsis RING-DUF1117 E3 ubiquitin ligases, AtRDUF1 and AtRDUF2, reduces tolerance to ABA-mediated drought stress.2012 · DOI: 10.1016/j.bbrc.2012.02.131

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035544 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0047484 regulation of response to osmotic stress Biological Process
GO:0090378 seed trichome elongation Biological Process
GO:1902006 negative regulation of L-proline biosynthetic process Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT2G40830
ath:AT3G19950
ath:AT3G56580
dosa:Os05g0488800
osa:4339152
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.482
Rank 1 · TkA07G088300 · TK1151
Cytoplasm0.481
Rank 2 · TkA07G088300 · TK1151
Cell membrane0.092
Rank 3 · TkA07G088300 · TK1151
Endoplasmic reticulum0.070
Rank 4 · TkA07G088300 · TK1151
Lysosome / Vacuole0.062
Rank 5 · TkA07G088300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12678zf-rbx111-23 aa
PF12861zf-ANAPC1165-77 aa
PF14634zf-RING_568-74 aa
PF00097zf-C3HC472-73 aa
PF23146Zf_IFT144_1st95-101 aa
PF13639zf-RING_296-112 aa
PF12678zf-rbx197-97 aa
PF13923zf-C3HC4_298-101 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G088300PF12678zf-rbx111232.8e-0525.0
TkA07G088300PF12861zf-ANAPC1165770.02815.2
TkA07G088300PF14634zf-RING_568740.01715.8
TkA07G088300PF00097zf-C3HC472732.6e-0627.9
TkA07G088300PF23146Zf_IFT144_1st951010.02415.2
TkA07G088300PF13639zf-RING_2961122.3e-1247.7
TkA07G088300PF12678zf-rbx197972.8e-0525.0
TkA07G088300PF13923zf-C3HC4_2981018.7e-0832.6
TkA07G088300PF12861zf-ANAPC11981020.02815.2
TkA07G088300PF14634zf-RING_51001030.01715.8
TkA07G088300PF00097zf-C3HC41031142.6e-0627.9
TkA07G088300PF23146Zf_IFT144_1st2202250.02415.2
TkA07G088300PF13639zf-RING_22212622.3e-1247.7
TkA07G088300PF13923zf-C3HC4_22212618.7e-0832.6
TkA07G088300PF17123zf-RING_112212487.2e-0729.5
TkA07G088300PF00097zf-C3HC42212612.6e-0627.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22283Arabidopsis thalianasp|O22283|RHC2A_ARATH Probable E3 ubiquitin-protein ligase RHC2A56.400%Swiss-ProtLow
Q8LPN7Arabidopsis thalianasp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like54.700%Swiss-ProtLow
Q94AK4Arabidopsis thalianasp|Q94AK4|RZF1_ARATH E3 ubiquitin-protein ligase RZF157.500%Swiss-ProtLow
Q940T5Arabidopsis thalianasp|Q940T5|RDUF2_ARATH E3 ubiquitin-protein ligase RDUF251.300%Swiss-ProtLow

JBrowse

View in Genome Browser