TkA07G084840 | RubberDandelionOmics

Gene overview

TkA07G084840

Reference: TK1151 Chr: Chr07 Coordinates: 22159389-22163241 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1167 bp · TkA07G084840|TK1151|cDNA

TTTTGGACGATCTGCTACCTCCGCCAGCCCGTCCGCCACCAACTGGTCACCGACTCCGCCTCCACCAGCACCGCCCAACCATCAATGCCGGCAAAGACGGCCACCATTACCACCGTTTTCTTCTCCGCCACCTCCTCTCGGATTTGTTCCATCGTCGTCCCACAGTGAAACGAGGCTTCAATTTAATTTCACATTTCCAGATCATATCAGGACTATAGTTGATGGAGTGGTTCCCGATTTTGGTTTCTGTAATTGTTGTT...

CDS

Download CDS FASTA

771 bp · TkA07G084840|TK1151|CDS

ATGGAGTGGTTCCCGATTTTGGTTTCTGTAATTGTTGTTTGGTTGGCTTCTCTTTGCAAAATTCTCCATGCATCATTCTATCCACCCCAATCTTCTTTTTTAGATAACAATGCTGGATCTATTCAGAAGAAAAATGTCTTACTGGTCATTGCACACCCTGATGATGAATCCATGTTCTTTTCACCAACAATCAATCAGCTGACTTCAAGAGGGCATAATGTTCACATATTGTGTCTGTCAACTGGTAATGCAGATGGACT...

Protein

Download Protein FASTA

256 aa · TkA07G084840|TK1151|PROTEIN

MEWFPILVSVIVVWLASLCKILHASFYPPQSSFLDNNAGSIQKKNVLLVIAHPDDESMFFSPTINQLTSRGHNVHILCLSTGNADGLGDVRKEELYKASAVLKVPLQQVTTLDHPDFQDGFGKVWDSSKLSKIVEKNVLAHAIDMIITFDNYGVSGHCNHRDVHQGVQRFMLDTSNKKVEAWELVSSNIVRKYSGPIDIWLSYWNLKGEMHCLLNEHPRRTYAAMSQHLSQWVWFRKLFVSFSSYTYVNTLRKIKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G084840`
TK1151 ID	TkA07G084840
OH-1004 ID	LXL04_027671
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G084840`
Location	Chr07:22159389-22163241 (-)
Description	Similar to pigl: Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027671` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006506 GPI anchor biosynthetic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0000225 N-acetylglucosaminylphosphatidylinositol deacetylase activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0293136 hsa:9487 mmu:327942 rno:192263 spo:2543490 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.722

Rank 1 · TkA07G084840 · TK1151

Golgi apparatus0.137

Rank 2 · TkA07G084840 · TK1151

Nucleus0.103

Rank 3 · TkA07G084840 · TK1151

Cytoplasm0.083

Rank 4 · TkA07G084840 · TK1151

Cell membrane0.053

Rank 5 · TkA07G084840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02585PIG-L47-169 aa

PF13477Glyco_trans_4_253-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G084840	`PF02585`	PIG-L	47	169	5.6e-26	92.3
TkA07G084840	`PF13477`	Glyco_trans_4_2	53	85	0.13	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card