TkA07G083820 | RubberDandelionOmics

Gene overview

TkA07G083820

Reference: TK1151 Chr: Chr07 Coordinates: 21909062-21910147 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · TkA07G083820|TK1151|cDNA

CCGATTATTACTTCTATATATCACGAATTAATTTCTTACATAATCTACCAAAAGACGCACCATCTCTTCTCATTCCACACACACACACACACACACACACACATACACACCTCCGCGAAGAAAAGTGAAAAATGGTGGTGAAGGTGTACGGACCCGCTTACGCCTCCCCGAAACGAGTTCTGGTTTGTCTTGTTGAAAAAGACATCGATTTCGAGACGGTTCCCGTCAACTTATTTACCGGCGAAAACAAAACTCCCGAG...

CDS

Download CDS FASTA

648 bp · TkA07G083820|TK1151|CDS

ATGGTGGTGAAGGTGTACGGACCCGCTTACGCCTCCCCGAAACGAGTTCTGGTTTGTCTTGTTGAAAAAGACATCGATTTCGAGACGGTTCCCGTCAACTTATTTACCGGCGAAAACAAAACTCCCGAGTTCCTGAAGTTACAGCCGTTTGGATCTGTTCCGGTAATTCAAGATGGAGATTTCACTCTCTTCGAATCACGAGCTATCATCCGCTACTACGCCGAAAAGTACAAGTCACAAGGAACCGATCTGCTGGGGAA...

Protein

Download Protein FASTA

215 aa · TkA07G083820|TK1151|PROTEIN

MVVKVYGPAYASPKRVLVCLVEKDIDFETVPVNLFTGENKTPEFLKLQPFGSVPVIQDGDFTLFESRAIIRYYAEKYKSQGTDLLGKTIEEEGLVNQWLEVEAHIFEPPVFNLVQQIMFSPYFGLTGDEKVIKESEEKLAKVLDVYEDRLSKSKYLAGDFFSLADLSHLGFTDYLVGPCGKGYMIKDRKHVSAWWDDITSRPSWKKVIETYGVPF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G083820`
TK1151 ID	TkA07G083820
OH-1004 ID	LXL04_027656
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G083820

Location Chr07:21909062-21910147 (+)

Description Similar to GSTF9: Glutathione S-transferase F9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30860`	In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC), and glutathione peroxidase activity toward cumene hydroperoxide and linoleic acid-13-hydroperoxide.	Probing the diversity of the Arabidopsis glutathione S-transferase gene family.2002 · DOI: 10.1023/a:1015557300450 Characterization of two Arabidopsis thaliana glutathione S-transferases.2006 · DOI: 10.1007/s00299-006-0146-1
`At2g30870`	In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC).	Probing the diversity of the Arabidopsis glutathione S-transferase gene family.2002 · DOI: 10.1023/a:1015557300450
`At3g03190`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At5g17220`	Involved in the transport and/or accumulation of both anthocyanins and proanthocyanidins (PA)s in the vacuole.	TRANSPARENT TESTA 19 is involved in the accumulation of both anthocyanins and proanthocyanidins in Arabidopsis.2004 · DOI: 10.1046/j.1365-313x.2003.01943.x The Arabidopsis tt19-4 mutant differentially accumulates proanthocyanidin and anthocyanin through a 3' amino acid substitution in glutathione S-transferase.2011 · DOI: 10.1111/j.1365-3040.2010.02249.x
`At3g62760`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027656 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0046283 anthocyanin-containing compound metabolic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:1900384 regulation of flavonol biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G30860

ath:AT2G30870

ath:AT3G03190

ath:AT3G62760

ath:AT5G17220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.841

Rank 1 · TkA07G083820 · TK1151

Nucleus0.234

Rank 2 · TkA07G083820 · TK1151

Mitochondrion0.061

Rank 3 · TkA07G083820 · TK1151

Peroxisome0.058

Rank 4 · TkA07G083820 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA07G083820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798GST_N1-74 aa

PF22527DEXQc_Suv39-41 aa

PF13417GST_N_310-78 aa

PF13409GST_N_214-75 aa

PF00043GST_C116-202 aa

PF22527DEXQc_Suv3125-141 aa

PF13417GST_N_3126-136 aa

PF13410GST_C_2131-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G083820	`PF02798`	GST_N	1	74	4.8e-17	62.8
TkA07G083820	`PF22527`	DEXQc_Suv3	9	41	0.25	11.6
TkA07G083820	`PF13417`	GST_N_3	10	78	9.9e-12	45.7
TkA07G083820	`PF13409`	GST_N_2	14	75	1.3e-14	55.2
TkA07G083820	`PF00043`	GST_C	116	202	1.2e-14	55.1
TkA07G083820	`PF22527`	DEXQc_Suv3	125	141	0.25	11.6
TkA07G083820	`PF13417`	GST_N_3	126	136	9.9e-12	45.7
TkA07G083820	`PF13410`	GST_C_2	131	194	0.00065	20.5
TkA07G083820	`PF14497`	GST_C_3	133	206	2.9e-07	31.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80852`	Arabidopsis thaliana	sp\|O80852\|GSTF9_ARATH Glutathione S-transferase F9	67.300%	Swiss-Prot	High
`P42761`	Arabidopsis thaliana	sp\|P42761\|GSTFA_ARATH Glutathione S-transferase F10	63.600%	Swiss-Prot	High
`Q96324`	Arabidopsis thaliana	sp\|Q96324\|GSTFB_ARATH Glutathione S-transferase F11	49.000%	Swiss-Prot	Medium
`Q9FE46`	Arabidopsis thaliana	sp\|Q9FE46\|GSTFC_ARATH Glutathione S-transferase F12	46.000%	Swiss-Prot	Medium
`Q9LZI9`	Arabidopsis thaliana	sp\|Q9LZI9\|GSTFD_ARATH Glutathione S-transferase F13	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card