Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3759 bp · TkA07G081890|TK1151|cDNA
GAAAAGTTGAGAATAGTGTATTATCCCATTTCTATAACGATTAACAACAAACGTTCCTCCGTCCGAGTGAAAGGTCTTCCTTGTGACCGATCGGCGATCACCACCGTCTTCAAATGTTCCGTCAAAAAGCCACCATTCCAAGTTCATAACGCAATCGTTTTCTCGTTGTAGCATACGACCTAGTAGCCATGAAGAGATTTTTCAGTAGAGGCACTTCCAATGACTCGTCTCCACAATCACCGTCGACGCCGTCTTCTTCA...
3195 bp · TkA07G081890|TK1151|CDS
ATGAAGAGATTTTTCAGTAGAGGCACTTCCAATGACTCGTCTCCACAATCACCGTCGACGCCGTCTTCTTCAACTCCTCTTTTTTCCCCATCCACTTCCGTCGCTTCCGGGCCTGCCAGGCCCATTCGCCTTGTCTATTGCGACGAGAGAGGGAAGTTTCAAATGGATCCCGAAGCTGTTTCTCTTCTTCAGCTTGTTAAAGAACCCATCGGCGTCGTTTCAGTCTGCGGTCGTGCTCGACAAGGCAAAAGTTATATCTT...
Protein
Download Protein FASTA1064 aa · TkA07G081890|TK1151|PROTEIN
MKRFFSRGTSNDSSPQSPSTPSSSTPLFSPSTSVASGPARPIRLVYCDERGKFQMDPEAVSLLQLVKEPIGVVSVCGRARQGKSYILNQLLGRSSGFKVASTHRPCTKGLWLWSTPLKRTALDGTEYNLLLIDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDEAALDRLSLVTEMTKHIRVRASGGKTTASELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLELALRPVEGMRKDISAKNEIRESIRALF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G081890 |
|---|---|
| TK1151 ID | TkA07G081890 |
| OH-1004 ID | LXL04_027635 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G081890 |
|---|---|
| Location | Chr07:21404752-21411103 (-) |
| Description | Similar to GBP2: Guanylate-binding protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001818 negative regulation of cytokine production Biological Process GO:0002218 activation of innate immune response Biological Process GO:0006955 immune response Biological Process GO:0009617 response to bacterium Biological Process GO:0032480 negative regulation of type I interferon production Biological Process GO:0034345 negative regulation of type III interferon production Biological Process GO:0034504 protein localization to nucleus Biological Process GO:0035458 cellular response to interferon-beta Biological Process GO:0042742 defense response to bacterium Biological Process GO:0042832 defense response to protozoan Biological Process GO:0043122 regulation of canonical NF-kappaB signal transduction Biological Process GO:0044406 adhesion of symbiont to host Biological Process |
| KEGG gene cross-reference | hsa:2634 mmu:229900 mmu:55932 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02263GBP52-309 aaPF01926MMR_HSR173-103 aaPF05879RHD3_GTPase79-154 aaPF02841GBP_C314-627 aaPF24643DUF7637327-371 aaPF23649FKBP15355-428 aaPF00261Tropomyosin424-450 aaPF18515Rh5424-446 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G081890 | PF02263 | GBP | 52 | 309 | 7.9e-62 | 209.5 |
| TkA07G081890 | PF01926 | MMR_HSR1 | 73 | 103 | 3.5 | 8.5 |
| TkA07G081890 | PF05879 | RHD3_GTPase | 79 | 154 | 0.019 | 15.0 |
| TkA07G081890 | PF02841 | GBP_C | 314 | 627 | 1.4e-30 | 107.5 |
| TkA07G081890 | PF24643 | DUF7637 | 327 | 371 | 0.14 | 13.0 |
| TkA07G081890 | PF23649 | FKBP15 | 355 | 428 | 1.9 | 8.7 |
| TkA07G081890 | PF00261 | Tropomyosin | 424 | 450 | 2.9e-05 | 24.4 |
| TkA07G081890 | PF18515 | Rh5 | 424 | 446 | 0.15 | 12.0 |
| TkA07G081890 | PF18515 | Rh5 | 497 | 568 | 0.15 | 12.0 |
| TkA07G081890 | PF29562 | DUF8567 | 501 | 579 | 0.062 | 13.8 |
| TkA07G081890 | PF11559 | ADIP | 502 | 553 | 0.017 | 15.9 |
| TkA07G081890 | PF25994 | HH_AprE | 504 | 638 | 4.4 | 8.1 |
| TkA07G081890 | PF23649 | FKBP15 | 519 | 686 | 1.9 | 8.7 |
| TkA07G081890 | PF00261 | Tropomyosin | 525 | 565 | 2.9e-05 | 24.4 |
| TkA07G081890 | PF05879 | RHD3_GTPase | 563 | 649 | 0.019 | 15.0 |
| TkA07G081890 | PF00261 | Tropomyosin | 584 | 797 | 2.9e-05 | 24.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.