RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G079080
Reference: TK1151 Chr: Chr07 Coordinates: 20652005-20664942 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2574 bp · TkA07G079080|TK1151|cDNA

ATGGTGGGATACCAGAAATCCGGTTCCGTCATGAAAGCACTTCTCCAGCAGAGAAATTTGTCAAGTCACTACCAGACAGAGTATTTGTTCACCACAGTTGGTCACAATGCTTATGGACAGGATCCTTATGCCAAGGAGTTTGGTATTAAAATTAGTCAGACTCTTGCCTCTGTTGAAGCATGTATCTTGCCTCTTCCTCGGCTTAAATACCATGATACTGGCCGTGAAAGGGACTGTCTGCCTCAAGTTGGCCAATGGAA...

CDS

Download CDS FASTA

2574 bp · TkA07G079080|TK1151|CDS

ATGGTGGGATACCAGAAATCCGGTTCCGTCATGAAAGCACTTCTCCAGCAGAGAAATTTGTCAAGTCACTACCAGACAGAGTATTTGTTCACCACAGTTGGTCACAATGCTTATGGACAGGATCCTTATGCCAAGGAGTTTGGTATTAAAATTAGTCAGACTCTTGCCTCTGTTGAAGCATGTATCTTGCCTCTTCCTCGGCTTAAATACCATGATACTGGCCGTGAAAGGGACTGTCTGCCTCAAGTTGGCCAATGGAA...

Protein

Download Protein FASTA

857 aa · TkA07G079080|TK1151|PROTEIN

MVGYQKSGSVMKALLQQRNLSSHYQTEYLFTTVGHNAYGQDPYAKEFGIKISQTLASVEACILPLPRLKYHDTGRERDCLPQVGQWNMMNKVVASQGWPEITKYAGCCSSKELIQDLFKERHDPNRRKISGGMIKELLISFRRATGQKPQRIISYSSIRFYFTCLMQSVRLVHHWSQIISLQYHLLWFKNVITPVYVIMEASGCCKINNGGCWHESRDDDSFSACLDHENGKCACPSGFKGDAVKSCEGKTAGKDVSRKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G079080
TK1151 IDTkA07G079080
OH-1004 IDLXL04_011395
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)56.100
Protein coverage (%)TK1151 39.090 / OH-1004 87.603
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G079080
LocationChr07:20652005-20664942 (+)
DescriptionSimilar to AGO1B: Protein argonaute 1B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g50000 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates (By similarity). No verified direct reference in this release
At5g67380 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.
Cloning and characterization of two cDNAs encoding casein kinase II catalytic subunits in Arabidopsis thaliana.1993 · DOI: 10.1007/bf00019944
Reconstitution of Arabidopsis casein kinase II from recombinant subunits and phosphorylation of transcription factor GBF1.1995 · DOI: 10.1105/tpc.7.1.105

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0729300 Probably involved in the RNA silencing pathway. No verified direct reference in this release
UniProt: Q9AR27 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. No verified direct reference in this release
UniProt: B6F107 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011395 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009616 RNAi-mediated antiviral immune response Biological Process
GO:0009733 response to auxin Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0009850 auxin metabolic process Biological Process
GO:0009955 adaxial/abaxial pattern specification Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010218 response to far red light Biological Process
GO:0010267 ta-siRNA processing Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0010589 leaf proximal/distal pattern formation Biological Process
GO:0016441 post-transcriptional gene silencing Biological Process
KEGG gene cross-reference
ath:AT1G48410
dosa:Os02g0672200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574
Rank 1 · TkA07G079080 · TK1151
Nucleus0.326
Rank 2 · TkA07G079080 · TK1151
Cell membrane0.102
Rank 3 · TkA07G079080 · TK1151
Endoplasmic reticulum0.095
Rank 4 · TkA07G079080 · TK1151
Lysosome / Vacuole0.087
Rank 5 · TkA07G079080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16488ArgoL233-70 aa
PF26097Phage_Inh_N43-54 aa
PF23947DUF728148-101 aa
PF26751All-alpha_MIP279-118 aa
PF16487ArgoMid81-110 aa
PF08183SpoV128-142 aa
PF00069Pkinase150-174 aa
PF30737PGAP4172-205 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G079080PF16488ArgoL233701.1e-2177.5
TkA07G079080PF26097Phage_Inh_N43540.08113.8
TkA07G079080PF23947DUF7281481010.1812.1
TkA07G079080PF26751All-alpha_MIP2791180.08912.4
TkA07G079080PF16487ArgoMid811100.0514.6
TkA07G079080PF08183SpoV1281420.05614.2
TkA07G079080PF00069Pkinase1501743e-1453.8
TkA07G079080PF30737PGAP41722052.08.6
TkA07G079080PF05473UL451962320.3111.3
TkA07G079080PF14670FXa_inhibition2052470.01516.2
TkA07G079080PF00954S_locus_glycop2212400.212.9
TkA07G079080PF00053EGF_laminin2232543.08.8
TkA07G079080PF02928zf-C5HC22242370.06314.3
TkA07G079080PF07974EGF_22252420.0001123.2
TkA07G079080PF12661hEGF2252390.0009520.2
TkA07G079080PF00008EGF2252425.68.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q08466Arabidopsis thalianasp|Q08466|CSK22_ARATH Casein kinase II subunit alpha-287.100%Swiss-ProtLow
Q08467Arabidopsis thalianasp|Q08467|CSK21_ARATH Casein kinase II subunit alpha-187.100%Swiss-ProtLow
Q5Z5B2Oryza sativa subsp. japonicasp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D28.600%Swiss-ProtLow
Q9AR27Oryza sativa subsp. indicasp|Q9AR27|HD6_ORYSI Casein kinase II subunit alpha-285.500%Swiss-ProtLow
B6F107Oryza sativa subsp. japonicasp|B6F107|HD6_ORYSJ Casein kinase II subunit alpha-285.500%Swiss-ProtLow

JBrowse

View in Genome Browser