TkA07G064100 | RubberDandelionOmics

Gene overview

TkA07G064100

Reference: TK1151 Chr: Chr07 Coordinates: 16951901-16952409 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA07G064100|TK1151|cDNA

ATGCAGTCAAAATTAGTTGACTTCGCATTGAGAGGCAGGATCCGTTCGCTAGCAAAGGATCAAAACGGCTGTCGACTACTTCAATCAAAATTCGAAAACCCAACAGCTGAAGAGATTGAAATCGTGCTCTATGACGTGCTTGAATCCATTGCCGATCTGATAAAAGACCAGTTCGGGAATTACTTAGTTCAAAAGCTCATTGCAATTTGCAACGATGATCACAAATTACGAATTCTTCTTTCCCTCACTGATGTCCCAGT...

CDS

Download CDS FASTA

414 bp · TkA07G064100|TK1151|CDS

ATGCAGTCAAAATTAGTTGACTTCGCATTGAGAGGCAGGATCCGTTCGCTAGCAAAGGATCAAAACGGCTGTCGACTACTTCAATCAAAATTCGAAAACCCAACAGCTGAAGAGATTGAAATCGTGCTCTATGACGTGCTTGAATCCATTGCCGATCTGATAAAAGACCAGTTCGGGAATTACTTAGTTCAAAAGCTCATTGCAATTTGCAACGATGATCACAAATTACGAATTCTTCTTTCCCTCACTGATGTCCCAGT...

Protein

Download Protein FASTA

137 aa · TkA07G064100|TK1151|PROTEIN

MQSKLVDFALRGRIRSLAKDQNGCRLLQSKFENPTAEEIEIVLYDVLESIADLIKDQFGNYLVQKLIAICNDDHKLRILLSLTDVPVQMILRIILVRARGQRREQSDGIHDRLQDPDPDPDIEEEDVLLKRRTSEIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G064100`
TK1151 ID	TkA07G064100
OH-1004 ID	LXL04_008705
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G064100

Location Chr07:16951901-16952409 (-)

Description Similar to APUM12: Pumilio homolog 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56510`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At1g22240`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At4g08840`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At1g35730`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At1g35750`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:1902039 negative regulation of seed dormancy process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G22240

ath:AT1G35730

ath:AT1G78160

ath:AT4G08840

ath:AT5G56510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.552

Rank 1 · TkA07G064100 · TK1151

Cytoplasm0.488

Rank 2 · TkA07G064100 · TK1151

Mitochondrion0.050

Rank 3 · TkA07G064100 · TK1151

Cell membrane0.042

Rank 4 · TkA07G064100 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA07G064100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00806PUF14-43 aa

PF22493PUF_NOP916-81 aa

PF00806PUF50-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G064100	`PF00806`	PUF	14	43	1.4e-16	60.5
TkA07G064100	`PF22493`	PUF_NOP9	16	81	0.11	12.1
TkA07G064100	`PF00806`	PUF	50	79	1.4e-16	60.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVC3`	Arabidopsis thaliana	sp\|Q9LVC3\|PUM12_ARATH Pumilio homolog 12	45.000%	Swiss-Prot	Medium
`Q9LM20`	Arabidopsis thaliana	sp\|Q9LM20\|PUM8_ARATH Putative pumilio homolog 8, chloroplastic	39.100%	Swiss-Prot	Medium
`Q9LDW3`	Arabidopsis thaliana	sp\|Q9LDW3\|PUM11_ARATH Pumilio homolog 11	41.300%	Swiss-Prot	Medium
`Q1PFN9`	Arabidopsis thaliana	sp\|Q1PFN9\|PUM9_ARATH Pumilio homolog 9	36.700%	Swiss-Prot	Medium
`Q9LP21`	Arabidopsis thaliana	sp\|Q9LP21\|PUM10_ARATH Putative pumilio homolog 10	31.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card