TkA07G057780 | RubberDandelionOmics

Gene overview

TkA07G057780

Reference: TK1151 Chr: Chr07 Coordinates: 15336539-15336949 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA07G057780|TK1151|cDNA

ATGACCGACATAACCATGCCCGGGAATCCCGGGCAGCACTATCCGTACCTCCCTTCCTCCACACCTCAAAGCCCCGGGCAGCTGACCCCGACCGGGTCGGGGTGGCTTTCCGGGGTCCAGACCCCACAAGACGGACCCTCTTCACCTACTTTCAGCCTTGTGGCATCGAACCCCGTTTGGGGGTACCGGGTCACGGATGTGGACCCCGGTCAAAGCGGGACGTGCTCGCCAGCTGTCACCGCGGGATTCGACCAAAACGC...

CDS

Download CDS FASTA

381 bp · TkA07G057780|TK1151|CDS

ATGACCGACATAACCATGCCCGGGAATCCCGGGCAGCACTATCCGTACCTCCCTTCCTCCACACCTCAAAGCCCCGGGCAGCTGACCCCGACCGGGTCGGGGTGGCTTTCCGGGGTCCAGACCCCACAAGACGGACCCTCTTCACCTACTTTCAGCCTTGTGGCATCGAACCCCGTTTGGGGGTACCGGGTCACGGATGTGGACCCCGGTCAAAGCGGGACGTGCTCGCCAGCTGTCACCGCGGGATTCGACCAAAACGC...

Protein

Download Protein FASTA

126 aa · TkA07G057780|TK1151|PROTEIN

MTDITMPGNPGQHYPYLPSSTPQSPGQLTPTGSGWLSGVQTPQDGPSSPTFSLVASNPVWGYRVTDVDPGQSGTCSPAVTAGFDQNADFAFGSSMKGLVKPWEGERIHEECVSDDLELTLGNPSTR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G057780`
TK1151 ID	TkA07G057780
OH-1004 ID	LXL04_027422
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.000
Protein coverage (%)	TK1151 100.000 / OH-1004 35.233 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G057780

Location Chr07:15336539-15336949 (+)

Description Similar to BEH4: BES1/BZR1 homolog protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18890`	BES1/BZR1 homolog protein 3.	No verified direct reference in this release
`At1g78700`	BES1/BZR1 homolog protein 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0552300`	May function in brassinosteroid signaling.	No verified direct reference in this release
`Os01g0203000`	May function in brassinosteroid signaling.	No verified direct reference in this release
`Os02g0233200`	May function in brassinosteroid signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027422 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G78700

ath:AT4G18890

dosa:Os01g0203000

dosa:Os02g0233200

dosa:Os06g0552300

osa:9267338

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.917

Rank 1 · TkA07G057780 · TK1151

Cytoplasm0.235

Rank 2 · TkA07G057780 · TK1151

Cell membrane0.025

Rank 3 · TkA07G057780 · TK1151

Mitochondrion0.021

Rank 4 · TkA07G057780 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA07G057780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49404`	Arabidopsis thaliana	sp\|O49404\|BEH3_ARATH BES1/BZR1 homolog protein 3	57.900%	Swiss-Prot	High
`Q9ZV88`	Arabidopsis thaliana	sp\|Q9ZV88\|BEH4_ARATH BES1/BZR1 homolog protein 4	51.500%	Swiss-Prot	High
`Q5Z9E5`	Oryza sativa subsp. japonica	sp\|Q5Z9E5\|BZR3_ORYSJ Protein BZR1 homolog 3	48.500%	Swiss-Prot	Medium
`Q0JPT4`	Oryza sativa subsp. japonica	sp\|Q0JPT4\|BZR2_ORYSJ Protein BZR1 homolog 2	45.400%	Swiss-Prot	Medium
`Q6EUF1`	Oryza sativa subsp. japonica	sp\|Q6EUF1\|BZR4_ORYSJ Protein BZR1 homolog 4	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card