TkA07G052130 | RubberDandelionOmics

Gene overview

TkA07G052130

Reference: TK1151 Chr: Chr07 Coordinates: 13831753-13836185 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1867 bp · TkA07G052130|TK1151|cDNA

AAAAGATTCAAAGCTCCCTATAAAAATAAAAACCCAAGCTCACAAAACTATTCAAGTTTCATTTGCTCACTACAATGGCTACCCCAAATTCTTCCCTCACTCTCCTTCTCTTGTTTATTGGTGTTTTATCAATATCAGTATCAGTATCATCGACTCTTCCTTCCGAGTTCTCCATACTCGGCGATCAAGAAATCAATGTCTTATCAAACGAAAAGATCCCTGAATTGTTCAAGAAATGGAAGGAGATGCATGGAAAATCA...

CDS

Download CDS FASTA

1503 bp · TkA07G052130|TK1151|CDS

ATGGCTACCCCAAATTCTTCCCTCACTCTCCTTCTCTTGTTTATTGGTGTTTTATCAATATCAGTATCAGTATCATCGACTCTTCCTTCCGAGTTCTCCATACTCGGCGATCAAGAAATCAATGTCTTATCAAACGAAAAGATCCCTGAATTGTTCAAGAAATGGAAGGAGATGCATGGAAAATCATACGAGCATGAAGAAGAGGAGGCACGAAGGCTTGTGAATTTCCGTAAGAGTTTGAAGTATATATTGGAGAAAAA...

Protein

Download Protein FASTA

500 aa · TkA07G052130|TK1151|PROTEIN

MATPNSSLTLLLLFIGVLSISVSVSSTLPSEFSILGDQEINVLSNEKIPELFKKWKEMHGKSYEHEEEEARRLVNFRKSLKYILEKNSKRKSETEHMVGLNKFADLSNEEFKEMYFSKNRGARSNKLKMRGEKRNTTLSSSSCDAPASLDWRDKGVVTPIKDQGQCGSCWAFSVTGSIEGAHAIATGDLISLSEQELVDCDTNDYGCDGGNMDTAYRWIIKNGGLDSEADYPYTSSNGRDGKCDKTKSQKSVVAIDSYVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G052130`
TK1151 ID	TkA07G052130
OH-1004 ID	LXL04_008086
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.500
Protein coverage (%)	TK1151 89.400 / OH-1004 94.372 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G052130

Location Chr07:13831753-13836185 (+)

Description Similar to RD21A: Cysteine proteinase RD21A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43060`	Probable thiol protease.	No verified direct reference in this release
`At1g47128`	Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0650000`	Oryzain alpha chain.	No verified direct reference in this release
`Os04g0670200`	Probable thiol protease.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008086 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G47128

ath:AT5G43060

dosa:Os04g0670200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.581

Rank 1 · TkA07G052130 · TK1151

Extracellular0.228

Rank 2 · TkA07G052130 · TK1151

Cytoplasm0.147

Rank 3 · TkA07G052130 · TK1151

Cell membrane0.116

Rank 4 · TkA07G052130 · TK1151

Endoplasmic reticulum0.116

Rank 5 · TkA07G052130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246Inhibitor_I2952-111 aa

PF24309IMEF_Flp61-116 aa

PF00112Peptidase_C1146-364 aa

PF03051Peptidase_C1_2159-175 aa

PF00396Granulin200-207 aa

PF03051Peptidase_C1_2306-345 aa

PF00396Granulin405-451 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G052130	`PF08246`	Inhibitor_I29	52	111	6e-15	56.0
TkA07G052130	`PF24309`	IMEF_Flp	61	116	0.19	12.3
TkA07G052130	`PF00112`	Peptidase_C1	146	364	3.8e-78	263.3
TkA07G052130	`PF03051`	Peptidase_C1_2	159	175	0.026	14.1
TkA07G052130	`PF00396`	Granulin	200	207	1.1e-05	26.2
TkA07G052130	`PF03051`	Peptidase_C1_2	306	345	0.026	14.1
TkA07G052130	`PF00396`	Granulin	405	451	1.1e-05	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMH8`	Arabidopsis thaliana	sp\|Q9FMH8\|RD21B_ARATH Probable cysteine protease RD21B	40.500%	Swiss-Prot	Medium
`P43297`	Arabidopsis thaliana	sp\|P43297\|RD21A_ARATH Cysteine proteinase RD21A	37.900%	Swiss-Prot	Medium
`P25776`	Oryza sativa subsp. japonica	sp\|P25776\|ORYA_ORYSJ Oryzain alpha chain	44.300%	Swiss-Prot	Medium
`P25777`	Oryza sativa subsp. japonica	sp\|P25777\|ORYB_ORYSJ Oryzain beta chain	44.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card