TkA07G048760 | RubberDandelionOmics

Gene overview

TkA07G048760

Reference: TK1151 Chr: Chr07 Coordinates: 12956989-12959036 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1410 bp · TkA07G048760|TK1151|cDNA

ATCTTAATATATTTGAAAATCGATTTGCAGAGTCAGGATTATCAAGTGATGACAAAGCTAGATCTTCATCCAGTTCTGGAATGAACATGCTAACAGGATCGGCAATCATGAGTCTAACAATAATTTGGCCATCAGTCATAACTTTTGGAAGTTATGATCTTTCAGATGATAATGATCACTTCATTATAGAAGACGAGCCATCATTCTTAACTAAATTAACAGCATATGGTGTTATAACTGATAAAGAAACAACTTATACG...

CDS

Download CDS FASTA

1254 bp · TkA07G048760|TK1151|CDS

ATGAACATGCTAACAGGATCGGCAATCATGAGTCTAACAATAATTTGGCCATCAGTCATAACTTTTGGAAGTTATGATCTTTCAGATGATAATGATCACTTCATTATAGAAGACGAGCCATCATTCTTAACTAAATTAACAGCATATGGTGTTATAACTGATAAAGAAACAACTTATACGGCAAGAATTATGCTTGTGTCACTTGTCCCTTTTATCATTCTCCAACTCCCAGCAATCATCAGTTCAATATCAATAACCCG...

Protein

Download Protein FASTA

417 aa · TkA07G048760|TK1151|PROTEIN

MNMLTGSAIMSLTIIWPSVITFGSYDLSDDNDHFIIEDEPSFLTKLTAYGVITDKETTYTARIMLVSLVPFIILQLPAIISSISITRVIILVTLIVVSSMFITNIVYQIFEPSIQNRRFAFVTKRFVKDKLQTLLSKNGKPNVRLIKKIYKELDKNHDGKVSKYELKIFLQGVQMQPGGSRKDDFVETIMDRFDISGDEYINETEFVRVLTIWLQDARKSVFQNDYDPLTFFLTPKPEAADKEQQKPLIPKETRNPRSSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G048760`
TK1151 ID	TkA07G048760
OH-1004 ID	LXL04_037710
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	31.000
Protein coverage (%)	TK1151 98.801 / OH-1004 73.183 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G048760

Location Chr07:12956989-12959036 (+)

Description Similar to NCL: Sodium/calcium exchanger NCL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53210`	Possesses sodium/calcium exchanger (NCX) activity when expressed in a heterologous mammalian CHO-K1 cell system.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0247800`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release
`Os01g0212400`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037710 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006814 sodium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0055074 calcium ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53210

ath:AT1G55720

dosa:Os01g0212400

dosa:Os02g0247800

osa:4325568

osa:4328874

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.609

Rank 1 · TkA07G048760 · TK1151

Lysosome / Vacuole0.160

Rank 2 · TkA07G048760 · TK1151

Endoplasmic reticulum0.153

Rank 3 · TkA07G048760 · TK1151

Cytoplasm0.090

Rank 4 · TkA07G048760 · TK1151

Golgi apparatus0.053

Rank 5 · TkA07G048760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699Na_Ca_ex1-63 aa

PF06022Cir_Bir_Yir60-107 aa

PF23564EF-hand_FSTL1126-171 aa

PF25578EF-hand_STIM1135-171 aa

PF13833EF-hand_8141-171 aa

PF30624EF_SSP120144-165 aa

PF13499EF-hand_7146-209 aa

PF00036EF-hand_1146-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G048760	`PF01699`	Na_Ca_ex	1	63	0.002	18.8
TkA07G048760	`PF06022`	Cir_Bir_Yir	60	107	0.51	10.5
TkA07G048760	`PF23564`	EF-hand_FSTL1	126	171	0.0047	18.0
TkA07G048760	`PF25578`	EF-hand_STIM1	135	171	0.26	12.1
TkA07G048760	`PF13833`	EF-hand_8	141	171	0.0018	18.7
TkA07G048760	`PF30624`	EF_SSP120	144	165	0.0068	17.7
TkA07G048760	`PF13499`	EF-hand_7	146	209	7.4e-12	46.2
TkA07G048760	`PF00036`	EF-hand_1	146	171	4e-10	39.2
TkA07G048760	`PF13405`	EF-hand_6	146	171	1.4e-08	34.5
TkA07G048760	`PF13202`	EF-hand_5	151	169	0.0019	18.3
TkA07G048760	`PF23564`	EF-hand_FSTL1	178	211	0.0047	18.0
TkA07G048760	`PF30624`	EF_SSP120	180	207	0.0068	17.7
TkA07G048760	`PF00036`	EF-hand_1	186	211	4e-10	39.2
TkA07G048760	`PF13833`	EF-hand_8	186	211	0.0018	18.7
TkA07G048760	`PF13405`	EF-hand_6	189	211	1.4e-08	34.5
TkA07G048760	`PF13202`	EF-hand_5	189	209	0.0019	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L636`	Arabidopsis thaliana	sp\|Q8L636\|NCL_ARATH Sodium/calcium exchanger NCL	33.300%	Swiss-Prot	Medium
`Q6K3R5`	Oryza sativa subsp. japonica	sp\|Q6K3R5\|NCL2_ORYSJ Sodium/calcium exchanger NCL2	33.700%	Swiss-Prot	Medium
`Q5QNI2`	Oryza sativa subsp. japonica	sp\|Q5QNI2\|NCL1_ORYSJ Sodium/calcium exchanger NCL1	31.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card