TkA07G044520 | RubberDandelionOmics

Gene overview

TkA07G044520

Reference: TK1151 Chr: Chr07 Coordinates: 11835012-11838809 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1508 bp · TkA07G044520|TK1151|cDNA

ATACATTTTACCTGGGCCGAAAGCCTTAACCATCTGTATCGGGAGTCGAAGCTATCGAAGATTGACCCATCTGCTTTTCACCAACCACGGAGGAGACGACGGCGAGACGGTGGAATCCGGCGAATAAAACCCTTGTTTCCTCTATAGCACTTTTTTTTTTTTTTTTTAATTCGAAGACGTAGTGATATGTTTTGAGAAAAAGTAAGGTCGAGAATTGAGGTATTCCGATCGCTTTTCCATAAAAAACATTGTCCATGGCA...

CDS

Download CDS FASTA

996 bp · TkA07G044520|TK1151|CDS

ATGGCAGGTGGACCAGATGGAGAAGACAAGGTATCATTGGAGCTCACTGAAGAAATCATTCAGAGCATGGAAGTAGGCATGGCATTCCGTGATTATAATGGTAGAATAAGTTCAATGGATTTTCACAGGACATCAAATTACTTGGTGACTGCTAGTGATGATGAATCCATTCGCCTCTATGATGTGTCTAATGCAACATGTTTAAAGACAATTAACAGCAAAAAGTATGGAGTTGACCTGGTTTCCTTCACTTCACACCC...

Protein

Download Protein FASTA

331 aa · TkA07G044520|TK1151|PROTEIN

MAGGPDGEDKVSLELTEEIIQSMEVGMAFRDYNGRISSMDFHRTSNYLVTASDDESIRLYDVSNATCLKTINSKKYGVDLVSFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCARTDCFISGSLDRTVLLWDQRADKCQGLLRVKGRPATAYDDQGLVFAVAFGGSIRMFDSRNYEKGPYEIFSVGGDVSDANVVKFSNDGKLMLLTTKDSRIHVLDSFRGTLLGTYNVNPVSSDSTLEASFSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G044520`
TK1151 ID	TkA07G044520
OH-1004 ID	LXL04_013818
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.800
Protein coverage (%)	TK1151 99.396 / OH-1004 96.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G044520

Location Chr07:11835012-11838809 (+)

Description Similar to APRF1: Protein ANTHESIS POMOTING FACTOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14530`	Component of a chromatin regulatory complex involved in regulating chromatin structure in the nucleus (By similarity).	APRF1 promotes flowering under long days in Arabidopsis thaliana.2016 · DOI: 10.1016/j.plantsci.2016.09.015

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013818 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001111 RNA polymerase II promoter clearance Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0009908 flower development Biological Process

GO:0010467 gene expression Biological Process

GO:0032785 negative regulation of DNA-templated transcription, elongation Biological Process

GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0071027 nuclear RNA surveillance Biological Process

GO:0110064 lncRNA catabolic process Biological Process

GO:0140744 negative regulation of lncRNA transcription Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

KEGG gene cross-reference

ath:AT5G14530

mmu:77305

xla:494657

xla:735072

xtr:448141

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.762

Rank 1 · TkA07G044520 · TK1151

Cytoplasm0.288

Rank 2 · TkA07G044520 · TK1151

Lysosome / Vacuole0.052

Rank 3 · TkA07G044520 · TK1151

Cell membrane0.039

Rank 4 · TkA07G044520 · TK1151

Golgi apparatus0.024

Rank 5 · TkA07G044520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07568HisKA_213-65 aa

PF25047Beta-prop_TEP1_2nd18-150 aa

PF23266VPS11_N21-76 aa

PF24814WD40_Prp1924-226 aa

PF25171Beta-prop_WDR36-Utp21_1st24-147 aa

PF24817WD40_WDHD1_1st27-81 aa

PF25391WD40_Gbeta27-111 aa

PF25168Beta-prop_WDR36-Utp21_2nd27-73 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G044520	`PF07568`	HisKA_2	13	65	0.31	11.9
TkA07G044520	`PF25047`	Beta-prop_TEP1_2nd	18	150	1.3e-12	48.2
TkA07G044520	`PF23266`	VPS11_N	21	76	0.084	12.6
TkA07G044520	`PF24814`	WD40_Prp19	24	226	2.6e-27	96.3
TkA07G044520	`PF25171`	Beta-prop_WDR36-Utp21_1st	24	147	1.7e-07	31.7
TkA07G044520	`PF24817`	WD40_WDHD1_1st	27	81	1.8e-23	83.9
TkA07G044520	`PF25391`	WD40_Gbeta	27	111	1.3e-19	71.2
TkA07G044520	`PF25168`	Beta-prop_WDR36-Utp21_2nd	27	73	8.7e-15	55.5
TkA07G044520	`PF20426`	NBCH_WD40	27	70	1.5e-10	41.2
TkA07G044520	`PF25174`	Beta-prop_THOC3	28	94	6.1e-31	108.2
TkA07G044520	`PF23414`	Beta-prop_EML_2	28	90	6.3e-19	69.1
TkA07G044520	`PF23385`	Beta-prop_IFT140_2nd	28	75	0.11	12.3
TkA07G044520	`PF25173`	Beta-prop_WDR3_1st	29	95	3.8e-28	99.1
TkA07G044520	`PF23381`	Beta-prop_IFT122_1st	29	96	3.6e-25	89.6
TkA07G044520	`PF24807`	WD40_CDC20-Fz	29	152	2.2e-21	77.2
TkA07G044520	`PF24805`	EIF3I	29	97	3.1e-20	73.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYK6`	Arabidopsis thaliana	sp\|Q9LYK6\|APRF1_ARATH Protein ANTHESIS PROMOTING FACTOR 1	51.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card