TkA07G043780 | RubberDandelionOmics

Gene overview

TkA07G043780

Reference: TK1151 Chr: Chr07 Coordinates: 11617678-11617998 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkA07G043780|TK1151|cDNA

ATGGACATCCAGCAATCAATCGCCAACCAAACTCACGTCTCCATCACACTCGCAAATCACCTCCTCTCCAAGAAATCCCTCAACTCCAACACTGTATTTTCGCCCCTTTCCATCCATGTCGACTTAGGCCTAGTCGCCGACGGTTCCAGTGGCCAAACACTCGATCAATTGCTGTCGTTTCTCAAAACAGAAACCATTGACGAACTCAACTCGCTTTCTTCACAGCTTGTGTCGTTGGTCTTCGCCGATGGTAGTCCAAG...

CDS

Download CDS FASTA

321 bp · TkA07G043780|TK1151|CDS

ATGGACATCCAGCAATCAATCGCCAACCAAACTCACGTCTCCATCACACTCGCAAATCACCTCCTCTCCAAGAAATCCCTCAACTCCAACACTGTATTTTCGCCCCTTTCCATCCATGTCGACTTAGGCCTAGTCGCCGACGGTTCCAGTGGCCAAACACTCGATCAATTGCTGTCGTTTCTCAAAACAGAAACCATTGACGAACTCAACTCGCTTTCTTCACAGCTTGTGTCGTTGGTCTTCGCCGATGGTAGTCCAAG...

Protein

Download Protein FASTA

106 aa · TkA07G043780|TK1151|PROTEIN

MDIQQSIANQTHVSITLANHLLSKKSLNSNTVFSPLSIHVDLGLVADGSSGQTLDQLLSFLKTETIDELNSLSSQLVSLVFADGSPSGGPRLAFANDGNFSSGPCI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G043780`
TK1151 ID	TkA07G043780
OH-1004 ID	LXL04_030413
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.800
Protein coverage (%)	TK1151 90.566 / OH-1004 11.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G043780

Location Chr07:11617678-11617998 (+)

Description Similar to At1g47710: Serpin-ZX

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47710`	Inhibits metacaspase-9 (MC9) cysteine protease.	No verified direct reference in this release
`At1g64030`	Probable serine protease inhibitor.	No verified direct reference in this release
`At2g14540`	Probable serine protease inhibitor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0533700`	Putative non-inhibitory serpin-Z11.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030413 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004867 serine-type endopeptidase inhibitor activity Molecular Function

GO:0004869 cysteine-type endopeptidase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G47710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.798

Rank 1 · TkA07G043780 · TK1151

Nucleus0.313

Rank 2 · TkA07G043780 · TK1151

Endoplasmic reticulum0.057

Rank 3 · TkA07G043780 · TK1151

Extracellular0.045

Rank 4 · TkA07G043780 · TK1151

Cell membrane0.029

Rank 5 · TkA07G043780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00079Serpin9-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G043780	`PF00079`	Serpin	9	95	1.5e-09	38.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7T8`	Arabidopsis thaliana	sp\|Q9S7T8\|SPZX_ARATH Serpin-ZX	54.200%	Swiss-Prot	High
`Q9SH52`	Arabidopsis thaliana	sp\|Q9SH52\|SPZ1_ARATH Serpin-Z1	42.300%	Swiss-Prot	Medium
`Q9ZQR6`	Arabidopsis thaliana	sp\|Q9ZQR6\|SPZ2_ARATH Serpin-Z2	41.200%	Swiss-Prot	Medium
`Q7XMK0`	Oryza sativa subsp. japonica	sp\|Q7XMK0\|SPZ11_ORYSJ Putative non-inhibitory serpin-Z11	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card