TkA07G041090 | RubberDandelionOmics

Gene overview

TkA07G041090

Reference: TK1151 Chr: Chr07 Coordinates: 10999920-11005371 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

750 bp · TkA07G041090|TK1151|cDNA

GAAATTATAAACCTTAGACTGCTCGGTACGGGAGGTAAACAGCCAGCGGTATCGGCCACGTCCGAGTTTACCGCTGGCGAACGGCGTGGAGCGGGTGATGCCAGCGGCAAAGTCCAACGGCAGCCAGACACCGATGGTAAAATTCGACTTTTGCAGGCTTTTTCTTGTATTTTTTGCATAGCACGGGAAATGGATCAAAGAAAGATGGCGGATTGGTCTGATGATGAAAGCGATTTCACAGAACAAATTGCCATGATAGC...

CDS

Download CDS FASTA

750 bp · TkA07G041090|TK1151|CDS

GAAATTATAAACCTTAGACTGCTCGGTACGGGAGGTAAACAGCCAGCGGTATCGGCCACGTCCGAGTTTACCGCTGGCGAACGGCGTGGAGCGGGTGATGCCAGCGGCAAAGTCCAACGGCAGCCAGACACCGATGGTAAAATTCGACTTTTGCAGGCTTTTTCTTGTATTTTTTGCATAGCACGGGAAATGGATCAAAGAAAGATGGCGGATTGGTCTGATGATGAAAGCGATTTCACAGAACAAATTGCCATGATAGC...

Protein

Download Protein FASTA

249 aa · TkA07G041090|TK1151|PROTEIN

EIINLRLLGTGGKQPAVSATSEFTAGERRGAGDASGKVQRQPDTDGKIRLLQAFSCIFCIAREMDQRKMADWSDDESDFTEQIAMIAMMGMQQVVQMSPIFNHILNGTAPVAFPENEVTAKFKSAQERARKDIERAFGALKKRWGILQRGARSTDRDKVARIMYACCILHNMILEDEGKTVCAYVAEENVVPNPPPIQPGSPESLAIRRALRNRPIHFRLRESLGLHLQIVDHVDLNEIPQDDAEEFSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G041090`
TK1151 ID	TkA07G041090
OH-1004 ID	LXL04_002104
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.000
Protein coverage (%)	TK1151 98.394 / OH-1004 76.901 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G041090

Location Chr07:10999920-11005371 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55350`	Transposase-derived protein that may have nuclease activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002104 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.659

Rank 1 · TkA07G041090 · TK1151

Cytoplasm0.349

Rank 2 · TkA07G041090 · TK1151

Mitochondrion0.068

Rank 3 · TkA07G041090 · TK1151

Cell membrane0.052

Rank 4 · TkA07G041090 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA07G041090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13359DDE_Tnp_454-87 aa

PF05378Hydant_A_N81-98 aa

PF04827Plant_tran93-110 aa

PF04827Plant_tran113-180 aa

PF01609DDE_Tnp_1117-168 aa

PF05378Hydant_A_N118-239 aa

PF13359DDE_Tnp_4121-171 aa

PF13586DDE_Tnp_1_2123-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G041090	`PF13359`	DDE_Tnp_4	54	87	3.6e-08	33.9
TkA07G041090	`PF05378`	Hydant_A_N	81	98	0.19	12.2
TkA07G041090	`PF04827`	Plant_tran	93	110	3.6e-19	69.9
TkA07G041090	`PF04827`	Plant_tran	113	180	3.6e-19	69.9
TkA07G041090	`PF01609`	DDE_Tnp_1	117	168	0.002	18.6
TkA07G041090	`PF05378`	Hydant_A_N	118	239	0.19	12.2
TkA07G041090	`PF13359`	DDE_Tnp_4	121	171	3.6e-08	33.9
TkA07G041090	`PF13586`	DDE_Tnp_1_2	123	155	0.2	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2U3`	Arabidopsis thaliana	sp\|Q9M2U3\|ALPL_ARATH Protein ALP1-like	33.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card