RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G024090
Reference: TK1151 Chr: Chr07 Coordinates: 6521421-6522854 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

525 bp · TkA07G024090|TK1151|cDNA

CTATCCTCTGCCAGCGACACTTTTCCAGTCGCTGCTCCGACCTGCTGCCTCCACTGCAACCAGTACCGACAGCATCTGCACCTCCCCTGCGAAGACCTCCTGCTCCGAGCTCGGCGCTGCTGCACTCGCAGGTTCTTCTTCCTGCCGGTGGTCGTTGCCTTCCCGGTTCTTCTTCCTGCCCGTGGAGAATCAGACCCAGATGCATTCAATCTTCTTCATCTCGAATCCAAATCCCAAACCAGATCCTTCATCTTCTTCAT...

CDS

Download CDS FASTA

525 bp · TkA07G024090|TK1151|CDS

CTATCCTCTGCCAGCGACACTTTTCCAGTCGCTGCTCCGACCTGCTGCCTCCACTGCAACCAGTACCGACAGCATCTGCACCTCCCCTGCGAAGACCTCCTGCTCCGAGCTCGGCGCTGCTGCACTCGCAGGTTCTTCTTCCTGCCGGTGGTCGTTGCCTTCCCGGTTCTTCTTCCTGCCCGTGGAGAATCAGACCCAGATGCATTCAATCTTCTTCATCTCGAATCCAAATCCCAAACCAGATCCTTCATCTTCTTCAT...

Protein

Download Protein FASTA

175 aa · TkA07G024090|TK1151|PROTEIN

LSSASDTFPVAAPTCCLHCNQYRQHLHLPCEDLLLRARRCCTRRFFFLPVVVAFPVLLPARGESDPDAFNLLHLESKSQTRSFIFFISNPNPKPDPIPEIPDPDAFNLWFCPGESEEGAASVLSFSQSKALVVVVVFWWLFFVPAVLMFFWRWLFEVLGSLDIFAPGIGLASCRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G024090
TK1151 IDTkA07G024090
OH-1004 IDLXL04_032698
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 22.350
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G024090
LocationChr07:6521421-6522854 (+)
DescriptionSimilar to ANX2: Receptor-like protein kinase ANXUR2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032698 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009723 response to ethylene Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0030308 negative regulation of cell growth Biological Process
KEGG gene cross-reference
ath:AT3G04690
ath:AT3G46290
ath:AT3G51550
ath:AT5G24010
ath:AT5G28680
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.437
Rank 1 · TkA07G024090 · TK1151
Nucleus0.415
Rank 2 · TkA07G024090 · TK1151
Endoplasmic reticulum0.142
Rank 3 · TkA07G024090 · TK1151
Cell membrane0.129
Rank 4 · TkA07G024090 · TK1151
Mitochondrion0.057
Rank 5 · TkA07G024090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser