TkA07G019960 | RubberDandelionOmics

Gene overview

TkA07G019960

Reference: TK1151 Chr: Chr07 Coordinates: 5399957-5400532 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · TkA07G019960|TK1151|cDNA

ATGAGTCCTACATCGTTTCTTTTATCCTCCTTTCTTCCCTTCCTTTTACTTTCTTCGTTCTTCCTAATCGCCATTAATGCCCAAAACCTCATCTACGAAACCTGCAAAACCTCCTCAAAACAAGACCCAAATGTCAACCTCCAATTTTGCACCACCTCTCTCCAAGCCGCACCAGCTAGCCACTGCGCTGACGTCACTGGCCTCGGAATGATGTCAATCAGGCTAACACGATACAATCTCACTGACACCAGATGTTACAT...

CDS

Download CDS FASTA

576 bp · TkA07G019960|TK1151|CDS

ATGAGTCCTACATCGTTTCTTTTATCCTCCTTTCTTCCCTTCCTTTTACTTTCTTCGTTCTTCCTAATCGCCATTAATGCCCAAAACCTCATCTACGAAACCTGCAAAACCTCCTCAAAACAAGACCCAAATGTCAACCTCCAATTTTGCACCACCTCTCTCCAAGCCGCACCAGCTAGCCACTGCGCTGACGTCACTGGCCTCGGAATGATGTCAATCAGGCTAACACGATACAATCTCACTGACACCAGATGTTACAT...

Protein

Download Protein FASTA

191 aa · TkA07G019960|TK1151|PROTEIN

MSPTSFLLSSFLPFLLLSSFFLIAINAQNLIYETCKTSSKQDPNVNLQFCTTSLQAAPASHCADVTGLGMMSIRLTRYNLTDTRCYIKQLLKNNTTKKLDPYVKACLNDCFELYSDAIPSIKQAMKSYNSKKYFDANVQISSVMDAATTCEDGFKEKKGVVSPLTKRNNASFQLSAVALSIMSIVQSDHSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G019960`
TK1151 ID	TkA07G019960
OH-1004 ID	LXL04_026942
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G019960`
Location	Chr07:5399957-5400532 (-)
Description	Similar to Putative invertase inhibitor
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026942` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009555 pollen development Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009846 pollen germination Biological Process GO:0009860 pollen tube growth Biological Process GO:0071669 plant-type cell wall organization or biogenesis Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009507 chloroplast Cellular Component GO:0012505 endomembrane system Cellular Component GO:0043667 pollen wall Cellular Component GO:0048046 apoplast Cellular Component
KEGG gene cross-reference	ath:AT3G17220 ath:AT5G46960 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.587

Rank 1 · TkA07G019960 · TK1151

Endoplasmic reticulum0.140

Rank 2 · TkA07G019960 · TK1151

Cytoplasm0.111

Rank 3 · TkA07G019960 · TK1151

Lysosome / Vacuole0.084

Rank 4 · TkA07G019960 · TK1151

Cell membrane0.079

Rank 5 · TkA07G019960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043PMEI30-181 aa

PF25071DUF779575-107 aa

PF05811DUF84292-127 aa

PF02953zf-Tim10_DDP92-125 aa

PF25071DUF7795124-155 aa

PF02953zf-Tim10_DDP131-143 aa

PF05811DUF842145-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G019960	`PF04043`	PMEI	30	181	9.1e-27	94.8
TkA07G019960	`PF25071`	DUF7795	75	107	0.049	14.3
TkA07G019960	`PF05811`	DUF842	92	127	0.042	14.3
TkA07G019960	`PF02953`	zf-Tim10_DDP	92	125	0.15	12.4
TkA07G019960	`PF25071`	DUF7795	124	155	0.049	14.3
TkA07G019960	`PF02953`	zf-Tim10_DDP	131	143	0.15	12.4
TkA07G019960	`PF05811`	DUF842	145	161	0.042	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card