TkA07G018030 | RubberDandelionOmics

Gene overview

TkA07G018030

Reference: TK1151 Chr: Chr07 Coordinates: 4840058-4841619 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1112 bp · TkA07G018030|TK1151|cDNA

TTATAATTGAAGGTAACTTTAGAACAAAGGTAAAGGAAAAATAGCCATGGAAGTAGAAAACATACTACACATGAATGTCGGTAATGGAGAATCAAGCTACGCGAGTAACTCTTTTCTTCAGGAAACTGTGATACGGGAAACTCTGCAAGTTTTGAAGCAGTCAATCAAGGGTATGGTTAATCTTGATGTGGCTTTCAACAAAAGTTTCGTACTAGCAGATTTAGGATGCGGCACGGGCACAAATACATTGTTGCTTGCAT...

CDS

Download CDS FASTA

909 bp · TkA07G018030|TK1151|CDS

ATGGAAGTAGAAAACATACTACACATGAATGTCGGTAATGGAGAATCAAGCTACGCGAGTAACTCTTTTCTTCAGGAAACTGTGATACGGGAAACTCTGCAAGTTTTGAAGCAGTCAATCAAGGGTATGGTTAATCTTGATGTGGCTTTCAACAAAAGTTTCGTACTAGCAGATTTAGGATGCGGCACGGGCACAAATACATTGTTGCTTGCATCTATGGTTATTGATACAGTCCTTGAGTTGTGCAAAGAACATGATCG...

Protein

Download Protein FASTA

302 aa · TkA07G018030|TK1151|PROTEIN

MEVENILHMNVGNGESSYASNSFLQETVIRETLQVLKQSIKGMVNLDVAFNKSFVLADLGCGTGTNTLLLASMVIDTVLELCKEHDRKAPHFQVCLNDLLGNDFNTIFQLLPNFYGNLKKKGENFGSCFVSAIPGSFYGRLFQDESLHLVHASYFCSLASQVPQGIENNKANIYMAKTSPPNVFEAYGKQFHTDFIKFLQLRSKELVHGGGRMVLTFLGRSSVDPTTDDCCRAFDLLARSLLCMVKEGLVEESYVNSFNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G018030`
TK1151 ID	TkA07G018030
OH-1004 ID	LXL04_026917
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.300
Protein coverage (%)	TK1151 99.338 / OH-1004 51.641 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G018030`
Location	Chr07:4840058-4841619 (-)
Description	Similar to BAMT: Benzoate carboxyl methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026917` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009723 response to ethylene Biological Process GO:0009856 pollination Biological Process GO:0032259 methylation Biological Process GO:0008168 methyltransferase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.825

Rank 1 · TkA07G018030 · TK1151

Nucleus0.278

Rank 2 · TkA07G018030 · TK1151

Endoplasmic reticulum0.059

Rank 3 · TkA07G018030 · TK1151

Plastid0.054

Rank 4 · TkA07G018030 · TK1151

Cell membrane0.037

Rank 5 · TkA07G018030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03492Methyltransf_75-296 aa

PF13649Methyltransf_2558-74 aa

PF26084PWI_Topors72-98 aa

PF13649Methyltransf_25141-153 aa

PF26084PWI_Topors244-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G018030	`PF03492`	Methyltransf_7	5	296	9.4e-103	344.7
TkA07G018030	`PF13649`	Methyltransf_25	58	74	0.25	12.7
TkA07G018030	`PF26084`	PWI_Topors	72	98	0.074	13.6
TkA07G018030	`PF13649`	Methyltransf_25	141	153	0.25	12.7
TkA07G018030	`PF26084`	PWI_Topors	244	259	0.074	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card