TkA07G017980 | RubberDandelionOmics

Gene overview

TkA07G017980

Reference: TK1151 Chr: Chr07 Coordinates: 4828030-4832075 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2704 bp · TkA07G017980|TK1151|cDNA

GATTTGTTTATTCATTATTCATGCGGACAGGACTGTTTTAGAGAAAGCGTTTAAAACTGAAGGGGCTAATTGTCATTTACCCAAACTGATTCACCCGTCTTTCCCCCATTGTAACAGGATCTTCTTCACTTCACTTGATCAGCAATTCCGCAATCAGAAAACCCAACTCCGATTCATCCCAAATCGATCAATTCACATCAAAATGACAGAATTTCTGGATTTAGAAACCCAAGACGCCGTCCGGATGCCATGGAACGTAC...

CDS

Download CDS FASTA

2223 bp · TkA07G017980|TK1151|CDS

ATGCATCATCCCCATCTCCGCCATCTACACCCCTCTCAAACCATTACCCAAAACCACCCCTCTCCTCCTTACTTACTCCCCTCTCCGCTGCCGGAATTGCCGATCGATCCTCAACCCATTCTCAATCGTCGATTTCTCCACCAAAATATGGATCTGCTCATTCTGCCTCCACCGCAACCACTTCCCGCCCACTACCAATCAATCACCGAGGACAACCTCCCGGCGGAACTCTTCCCTCAGTACACCACCATCGAATACGA...

Protein

Download Protein FASTA

740 aa · TkA07G017980|TK1151|PROTEIN

MHHPHLRHLHPSQTITQNHPSPPYLLPSPLPELPIDPQPILNRRFLHQNMDLLILPPPQPLPAHYQSITEDNLPAELFPQYTTIEYELQNEKPPSPITSQVFLFVVDTCIIEEEIGFLRSGLSRAIGEIPGNSLVGLITFGRYVCVHELGFFGKIPKVYVFNGSKEISKDQVLEQMGFFLKKARPATGGGPGTRDGHLQDNVSRFLLPASECEFAVNSVLDELQRDAWPVPGDQRAARCTGTALSVSAHLLGACVPGCGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G017980`
TK1151 ID	TkA07G017980
OH-1004 ID	LXL04_026915
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 91.757 / OH-1004 88.396 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G017980

Location Chr07:4828030-4832075 (-)

Description Similar to SEC23: Protein transport protein SEC23 (Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21630`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release
`At3g23660`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release
`At4g14160`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release
`At1g05520`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026915 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0090110 COPII-coated vesicle cargo loading Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0070971 endoplasmic reticulum exit site Cellular Component

GO:0005096 GTPase activator activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05520

ath:AT2G21630

ath:AT3G23660

ath:AT4G14160

mgr:MGG_06910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.592

Rank 1 · TkA07G017980 · TK1151

Golgi apparatus0.210

Rank 2 · TkA07G017980 · TK1151

Nucleus0.200

Rank 3 · TkA07G017980 · TK1151

Endoplasmic reticulum0.122

Rank 4 · TkA07G017980 · TK1151

Lysosome / Vacuole0.116

Rank 5 · TkA07G017980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04811Sec23_trunk100-366 aa

PF28438RelA_RIS127-148 aa

PF28438RelA_RIS222-234 aa

PF08033Sec23_BS377-483 aa

PF04815Sec23_helical497-595 aa

PF08033Sec23_BS569-599 aa

PF00626Gelsolin611-697 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G017980	`PF04811`	Sec23_trunk	100	366	2e-57	195.3
TkA07G017980	`PF28438`	RelA_RIS	127	148	0.032	14.7
TkA07G017980	`PF28438`	RelA_RIS	222	234	0.032	14.7
TkA07G017980	`PF08033`	Sec23_BS	377	483	4.2e-22	79.3
TkA07G017980	`PF04815`	Sec23_helical	497	595	5.6e-25	87.8
TkA07G017980	`PF08033`	Sec23_BS	569	599	4.2e-22	79.3
TkA07G017980	`PF00626`	Gelsolin	611	697	5.1e-14	52.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIJ7`	Arabidopsis thaliana	sp\|Q9SIJ7\|SC23C_ARATH Protein transport protein SEC23 C	65.100%	Swiss-Prot	High
`Q9LUG1`	Arabidopsis thaliana	sp\|Q9LUG1\|SC23E_ARATH Protein transport protein SEC23 E	62.700%	Swiss-Prot	High
`Q8VXX0`	Arabidopsis thaliana	sp\|Q8VXX0\|SC23F_ARATH Protein transport protein SEC23 F	61.900%	Swiss-Prot	High
`Q8H0S3`	Arabidopsis thaliana	sp\|Q8H0S3\|SC23B_ARATH Protein transport protein SEC23 B	61.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card