TkA07G017880 | RubberDandelionOmics

Gene overview

TkA07G017880

Reference: TK1151 Chr: Chr07 Coordinates: 4802318-4803223 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · TkA07G017880|TK1151|cDNA

ATGATTTTTAGACCCAATATCTCAAGAACTTTTCTATCCTTGATCATATTCACACTGTTACTTGTTATCAAGAGTTCTAATGCTGGCGAAATCTCCATATACTGGGGTCAAAACGGAAATGAAGGAACTTTAGCAAACACGTGTTTCACAGGGAACTACGAGTATGTAAACATCGCCTTCCTTTCCTCATTTGGAAACGGCCAAAATCCAATTCTGAACCTTGCGGGACATTGTGATCCACGTGGCAATGGTTGCACAAA...

CDS

Download CDS FASTA

906 bp · TkA07G017880|TK1151|CDS

ATGATTTTTAGACCCAATATCTCAAGAACTTTTCTATCCTTGATCATATTCACACTGTTACTTGTTATCAAGAGTTCTAATGCTGGCGAAATCTCCATATACTGGGGTCAAAACGGAAATGAAGGAACTTTAGCAAACACGTGTTTCACAGGGAACTACGAGTATGTAAACATCGCCTTCCTTTCCTCATTTGGAAACGGCCAAAATCCAATTCTGAACCTTGCGGGACATTGTGATCCACGTGGCAATGGTTGCACAAA...

Protein

Download Protein FASTA

301 aa · TkA07G017880|TK1151|PROTEIN

MIFRPNISRTFLSLIIFTLLLVIKSSNAGEISIYWGQNGNEGTLANTCFTGNYEYVNIAFLSSFGNGQNPILNLAGHCDPRGNGCTNLSSDIKSCQSKGVKVILSIGGATGRYNLASDADARKVATYIWNNFLGGKSSTRPLGDAILDGVDFDIERGDGKHWDDLAKYISAYSKRGKKVYLTAAPQCPYPDAWMGTALQTGVFDYVWVQFYNNPQCQYNSRNINSFQNSWKQWTSNIPVQKIFLGLPAAPDAAGSGFISV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G017880`
TK1151 ID	TkA07G017880
OH-1004 ID	LXL04_026914
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G017880

Location Chr07:4802318-4803223 (+)

Description Similar to Hevamine-A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24090`	This protein functions as a defense against chitin containing fungal pathogens.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026914 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009611 response to wounding Biological Process

GO:0009642 response to light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0003796 lysozyme activity Molecular Function

KEGG gene cross-reference

ath:AT5G24090

nta:107825584

vvi:100233088

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.974

Rank 1 · TkA07G017880 · TK1151

Cytoplasm0.016

Rank 2 · TkA07G017880 · TK1151

Cell membrane0.012

Rank 3 · TkA07G017880 · TK1151

Endoplasmic reticulum0.006

Rank 4 · TkA07G017880 · TK1151

Lysosome / Vacuole0.005

Rank 5 · TkA07G017880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00704Glyco_hydro_1831-249 aa

PF23916TIM-barrel_EndoS45-69 aa

PF23916TIM-barrel_EndoS95-246 aa

PF00704Glyco_hydro_18263-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G017880	`PF00704`	Glyco_hydro_18	31	249	1.2e-25	91.6
TkA07G017880	`PF23916`	TIM-barrel_EndoS	45	69	5.2e-05	23.8
TkA07G017880	`PF23916`	TIM-barrel_EndoS	95	246	5.2e-05	23.8
TkA07G017880	`PF00704`	Glyco_hydro_18	263	288	1.2e-25	91.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P19172`	Arabidopsis thaliana	sp\|P19172\|CHIA_ARATH Acidic endochitinase	62.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card