TkA07G017840 | RubberDandelionOmics

Gene overview

TkA07G017840

Reference: TK1151 Chr: Chr07 Coordinates: 4790200-4790610 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA07G017840|TK1151|cDNA

ATGGCAAGAACCAAGCAAACTGCTCGCAAATCCACCGGCGGTAAAGCACCAAGGAAACAGCTTGCAACAAAGGCGGCAAGGAAATCAGCTCCGGCGACCGGCGGAGTTAAGAAGCCACACAGATTCAGGCCAGGAACTGTCGCTCTTCGTGAAATCCGTAAGTACCAGAAGAGCACCGAACTAGTGAGAGAAATCGCACAGGATTTCAAGACCGATCTGAGGTTTCAAAGCAGTGCGGTGGCTGCACTTCAGGAGGCGTC...

CDS

Download CDS FASTA

381 bp · TkA07G017840|TK1151|CDS

ATGGCAAGAACCAAGCAAACTGCTCGCAAATCCACCGGCGGTAAAGCACCAAGGAAACAGCTTGCAACAAAGGCGGCAAGGAAATCAGCTCCGGCGACCGGCGGAGTTAAGAAGCCACACAGATTCAGGCCAGGAACTGTCGCTCTTCGTGAAATCCGTAAGTACCAGAAGAGCACCGAACTAGTGAGAGAAATCGCACAGGATTTCAAGACCGATCTGAGGTTTCAAAGCAGTGCGGTGGCTGCACTTCAGGAGGCGTC...

Protein

Download Protein FASTA

126 aa · TkA07G017840|TK1151|PROTEIN

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELVREIAQDFKTDLRFQSSAVAALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G017840`
TK1151 ID	TkA07G017840
OH-1004 ID	LXL04_004403
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G017840

Location Chr07:4790200-4790610 (+)

Description Similar to B34: Histone H3.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P59226`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004403 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0031492 nucleosomal DNA binding Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0866200

dosa:Os04g0419600

dosa:Os05g0438700

dosa:Os06g0160100

dosa:Os11g0155900

nta:107759185

nta:107759464

nta:107763111

nta:107769564

nta:107794615

nta:107798424

nta:107816172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.914

Rank 1 · TkA07G017840 · TK1151

Cytoplasm0.083

Rank 2 · TkA07G017840 · TK1151

Extracellular0.051

Rank 3 · TkA07G017840 · TK1151

Mitochondrion0.009

Rank 4 · TkA07G017840 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA07G017840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15715PAF1-58 aa

PF15511CENP-T_C19-30 aa

PF26848Phage_T5_Nicking_endo19-108 aa

PF00125Histone44-121 aa

PF15511CENP-T_C59-120 aa

PF00808CBFD_NFYB_HMF67-118 aa

PF15630CENP-S68-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G017840	`PF15715`	PAF	1	58	0.0012	20.3
TkA07G017840	`PF15511`	CENP-T_C	19	30	1.7e-05	25.6
TkA07G017840	`PF26848`	Phage_T5_Nicking_endo	19	108	0.019	15.5
TkA07G017840	`PF00125`	Histone	44	121	1.5e-27	96.5
TkA07G017840	`PF15511`	CENP-T_C	59	120	1.7e-05	25.6
TkA07G017840	`PF00808`	CBFD_NFYB_HMF	67	118	0.052	14.5
TkA07G017840	`PF15630`	CENP-S	68	120	0.00019	22.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59226`	Arabidopsis thaliana	sp\|P59226\|H31_ARATH Histone H3.1	91.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card