RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G016590
Reference: TK1151 Chr: Chr07 Coordinates: 4494498-4496808 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1372 bp · TkA07G016590|TK1151|cDNA

CCGGTCTATTTATTTTTATGAAACCCTAAAATCCCTTTTCTTTCACAAATCTCACCGGCCACACATCATTAAGGCCGCTCCTTTCTATTCTCCATCGGCGCCACTGAAGACGACGGGCCAAAAAAGCTCAGGTCCGACGATGTGCTCCGACGATGTTCTTGGGTGATAATTTCAGTACGAAGACGTCATCCGAAGGTTCTCGGAAGATCTCTCCTCGATCGATTTCTTCAGACACGGGCCAAAAAAGCTCAGGTCGAACC...

CDS

Download CDS FASTA

951 bp · TkA07G016590|TK1151|CDS

ATGTTCTTGGGTGATAATTTCAGTACGAAGACGTCATCCGAAGGTTCTCGGAAGATCTCTCCTCGATCGATTTCTTCAGACACGGGCCAAAAAAGCTCAGGTCGAACCGCACGCCAACTGAAGACGACTGGACTCAAACCCAACTCTTCTTCTCTCAATCAACCAACCATTAGAACACCAAAACGTACAACTCCTGTAATCGTTGCTCGCAGGTCGCCTCAAAGCTCGATTTCTGAGAAGAAACGTCCAGTCAAAGTTGC...

Protein

Download Protein FASTA

316 aa · TkA07G016590|TK1151|PROTEIN

MFLGDNFSTKTSSEGSRKISPRSISSDTGQKSSGRTARQLKTTGLKPNSSSLNQPTIRTPKRTTPVIVARRSPQSSISEKKRPVKVAELETQISQLKDDLKNVKDELVSSESWKDQAKQDAEESRKQLLAIFLSRYRGEYNGQDVAIKILKSEHLNESLEDEFAHEVAMLKEVRHTNVVRFIGACTKQPPLCIITEYMSGGSLYDYLHNKKHNVLMLPELLKFGINICKGMEYLHNNNIIHRDLKTANLLLDSQNVPYEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G016590
TK1151 IDTkA07G016590
OH-1004 IDLXL04_031243
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)72.800
Protein coverage (%)TK1151 55.696 / OH-1004 40.728
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G016590
LocationChr07:4494498-4496808 (+)
DescriptionSimilar to STY17: Serine/threonine-protein kinase STY17
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g38470 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At4g35780 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At2g17700 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At2g24360 Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.
Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
At1g62400 Serine/threonine/tyrosine kinase involved in the control of stomatal movement in response to CO(2). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031243 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010344 seed oilbody biogenesis Biological Process
GO:0045995 regulation of embryonic development Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT2G17700
ath:AT2G24360
ath:AT4G35780
ath:AT4G38470
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.608
Rank 1 · TkA07G016590 · TK1151
Cell membrane0.254
Rank 2 · TkA07G016590 · TK1151
Nucleus0.231
Rank 3 · TkA07G016590 · TK1151
Golgi apparatus0.078
Rank 4 · TkA07G016590 · TK1151
Endoplasmic reticulum0.052
Rank 5 · TkA07G016590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22469RavJ_Peptidase6-78 aa
PF26095CC_Bre163-130 aa
PF12443AKNA73-128 aa
PF14282FlxA76-121 aa
PF28297CCDC3_C82-124 aa
PF27944CEP162_coil_mid87-105 aa
PF02758PYRIN97-157 aa
PF07714PK_Tyr_Ser-Thr137-255 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G016590PF22469RavJ_Peptidase6780.2311.7
TkA07G016590PF26095CC_Bre1631300.1113.5
TkA07G016590PF12443AKNA731280.1813.1
TkA07G016590PF14282FlxA761210.1712.8
TkA07G016590PF28297CCDC3_C821240.4611.5
TkA07G016590PF27944CEP162_coil_mid871050.1412.9
TkA07G016590PF02758PYRIN971570.1712.9
TkA07G016590PF07714PK_Tyr_Ser-Thr1372551.2e-44153.3
TkA07G016590PF27944CEP162_coil_mid1381730.1412.9
TkA07G016590PF00069Pkinase1412551.1e-31110.9
TkA07G016590PF03109ABC11411600.01814.9
TkA07G016590PF03109ABC11922550.01814.9
TkA07G016590PF07714PK_Tyr_Ser-Thr2563081.2e-44153.3
TkA07G016590PF00069Pkinase2733071.1e-31110.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4JTP5Arabidopsis thalianasp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY4644.800%Swiss-ProtMedium
Q8RWL6Arabidopsis thalianasp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY1757.000%Swiss-ProtLow
O22558Arabidopsis thalianasp|O22558|STY8_ARATH Serine/threonine-protein kinase STY855.600%Swiss-ProtLow
Q9ZQ31Arabidopsis thalianasp|Q9ZQ31|STY13_ARATH Serine/threonine-protein kinase STY1344.300%Swiss-ProtLow
Q2MHE4Arabidopsis thalianasp|Q2MHE4|HT1_ARATH Serine/threonine/tyrosine-protein kinase HT139.300%Swiss-ProtLow

JBrowse

View in Genome Browser