RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G012120
Reference: TK1151 Chr: Chr07 Coordinates: 3293011-3296975 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1216 bp · TkA07G012120|TK1151|cDNA

CGAATTGCTATCCTATATAGTGGGTCTTTCTCTCTCAACCTCTTTTCTCTCACATTCTTATTTGTAGCTTCCTTCTCACTTGTCTTTGAGAACGCACACACATAAACACAAGGAGGTCAGATCCCAAAGGTGGTTAATCTGTCCATCAATCAATCCAAATACATTGTTCAGTCAATCTTTTCAATCAATCAAATCAAACTGTGAGAGAGTATCAAACAGGAAGAGAGAGAGTAGAAAGGGCAAAGGTGAGGAAAAACATG...

CDS

Download CDS FASTA

672 bp · TkA07G012120|TK1151|CDS

ATGTCATCTTCAGCTGCTTTTTCACCGGACCACCACCACCACCACCTCTCTCCTCCCTCCGAGCAGCTCTGTTATGTCCAATGCAACTACTGTGAAACTGTCCTCGCGGTGAGTGTTCCTTGCAGCAGTTTGTTCGCTACCGTTACTGTTCGATGTGGGCACTGCACGACTCTCTTGTCTGTCAACATGCGCGGCCTTCTCTTTCCTGCCTCCGCCGCAGCTATGGCCGCCAACGCCGCCGCTAATCAACTCCATATTCC...

Protein

Download Protein FASTA

223 aa · TkA07G012120|TK1151|PROTEIN

MSSSAAFSPDHHHHHLSPPSEQLCYVQCNYCETVLAVSVPCSSLFATVTVRCGHCTTLLSVNMRGLLFPASAAAMAANAAANQLHIPHNFFSPQNLMEEMRNVPSNLFINHPNPNDGVTPVRIDELPKPPVANRPPEKRQRVPSAYNKFIKEEIQRIKAGNPDISHREAFSAAAKNWAHYPHIHFGLMPDQPVKKPNVCQQEGDDLLMKDGFLTTANVGVSPY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G012120
TK1151 IDTkA07G012120
OH-1004 IDLXL04_026563
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)58.500
Protein coverage (%)TK1151 100.000 / OH-1004 81.362
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G012120
LocationChr07:3293011-3296975 (+)
DescriptionSimilar to YAB1: Axial regulator YABBY 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g45190 Involved in the abaxial cell fate determination during embryogenesis and organogenesis. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2X7Q3 Protein YABBY 4. No verified direct reference in this release
Os02g0643200 Seems to be associated with phloem cell differentiation. No verified direct reference in this release
UniProt: Q01JG2 May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. No verified direct reference in this release
Os04g0536300 May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026563 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0009933 meristem structural organization Biological Process
GO:0009944 polarity specification of adaxial/abaxial axis Biological Process
GO:0010093 specification of floral organ identity Biological Process
GO:0010154 fruit development Biological Process
GO:0010158 abaxial cell fate specification Biological Process
GO:0010450 inflorescence meristem growth Biological Process
GO:0045165 cell fate commitment Biological Process
GO:0090706 specification of plant organ position Biological Process
GO:1902183 regulation of shoot apical meristem development Biological Process
GO:2000024 regulation of leaf development Biological Process
KEGG gene cross-reference
ath:AT2G45190
ath:AT4G00180
dosa:Os02g0643200
dosa:Os04g0536300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.834
Rank 1 · TkA07G012120 · TK1151
Cytoplasm0.236
Rank 2 · TkA07G012120 · TK1151
Cell membrane0.057
Rank 3 · TkA07G012120 · TK1151
Endoplasmic reticulum0.048
Rank 4 · TkA07G012120 · TK1151
Lysosome / Vacuole0.016
Rank 5 · TkA07G012120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02892zf-BED15-37 aa
PF24868YABBY_N19-69 aa
PF23547Zn_ribbon_FGT1_124-38 aa
PF11331Zn_ribbon_1225-62 aa
PF13719Zn_ribbon_527-57 aa
PF23547Zn_ribbon_FGT1_148-62 aa
PF02892zf-BED50-59 aa
PF04690YABBY79-88 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G012120PF02892zf-BED15371.39.8
TkA07G012120PF24868YABBY_N19695.1e-29100.3
TkA07G012120PF23547Zn_ribbon_FGT1_124383.68.0
TkA07G012120PF11331Zn_ribbon_1225620.3511.4
TkA07G012120PF13719Zn_ribbon_527574.57.8
TkA07G012120PF23547Zn_ribbon_FGT1_148623.68.0
TkA07G012120PF02892zf-BED50591.39.8
TkA07G012120PF04690YABBY79881.2e-36125.6
TkA07G012120PF04690YABBY1261861.2e-36125.6
TkA07G012120PF06244Ccdc1241321810.002518.8
TkA07G012120PF09011HMG_box_21361780.0006121.1
TkA07G012120PF00505HMG_box1411780.01816.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22152Arabidopsis thalianasp|O22152|YAB1_ARATH Axial regulator YABBY 161.600%Swiss-ProtHigh
A2X7Q3Oryza sativa subsp. indicasp|A2X7Q3|YAB4_ORYSI Protein YABBY 453.500%Swiss-ProtHigh
Q6H668Oryza sativa subsp. japonicasp|Q6H668|YAB4_ORYSJ Protein YABBY 453.500%Swiss-ProtHigh
Q01JG2Oryza sativa subsp. indicasp|Q01JG2|YAB5_ORYSI Protein YABBY 548.900%Swiss-ProtMedium
Q0JBF0Oryza sativa subsp. japonicasp|Q0JBF0|YAB5_ORYSJ Protein YABBY 548.900%Swiss-ProtMedium

JBrowse

View in Genome Browser