TkA07G010230 | RubberDandelionOmics

Gene overview

TkA07G010230

Reference: TK1151 Chr: Chr07 Coordinates: 2814956-2816969 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1033 bp · TkA07G010230|TK1151|cDNA

AGGATTCAGATTTTTCCCCTCCACAGCACCCTCGATCGAAGATTACCCAGGTAACTATCTCCATTCAAACTCCTCTCTTAATTTCCGCCATGATTGTTACCTTATGGTTCAAGTATGCTCGTCTACCAATTTTCATTCGATTTTACTCCAATTTGATGAGCTCAATCGTTCGACTAACTTCGTGGGATGAATTCAGATTTCTGCATGGTGACAGCAATTCTAATGCCATCATGTGGCAATCTTGATAACATTTGTTGTAC...

CDS

Download CDS FASTA

618 bp · TkA07G010230|TK1151|CDS

ATGAATTCAGATTTCTGCATGGTGACAGCAATTCTAATGCCATCATGTGGCAATCTTGATAACATTTGTTGTACATGTGGACATTCAAGATCAAAGGTGTCATCTATCCGTTTTTCATCTATTTCCTTATTAAAAACTTCATCCTCATTCCGGAAGACATTGTATGCTCGGTTTTGGATCTTCCATTTGACCCAACCTTTTCTTATCAAGGTCTCCAAGGGGAAATCATCACGTATAAGAAGCAGTGCAGACGGAAAAAG...

Protein

Download Protein FASTA

205 aa · TkA07G010230|TK1151|PROTEIN

MNSDFCMVTAILMPSCGNLDNICCTCGHSRSKVSSIRFSSISLLKTSSSFRKTLYARFWIFHLTQPFLIKVSKGKSSRIRSSADGKSGLNPSAPNNRGTRLIRAIQAFQTIISERIKTLKKNLPMKLLFFLTGFYCSTAFATVIGQTGDWDILSAALAVAVVEGIGALMYTGSFPLFDKVRKLVTMFNYWKVGLSMGLFLDSFKY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G010230`
TK1151 ID	TkA07G010230
OH-1004 ID	LXL04_031313
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.000
Protein coverage (%)	TK1151 36.585 / OH-1004 20.604 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G010230

Location Chr07:2814956-2816969 (-)

Description Similar to PBG1: Proteasome subunit beta type-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65420`	Ycf20-like protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031313 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002376 immune system process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0010499 proteasomal ubiquitin-independent protein catabolic process Biological Process

GO:0030317 flagellated sperm motility Biological Process

GO:0032743 positive regulation of interleukin-2 production Biological Process

GO:0032760 positive regulation of tumor necrosis factor production Biological Process

GO:0034341 response to type II interferon Biological Process

KEGG gene cross-reference

ath:AT1G56450

bta:506203

hsa:5692

mmu:19172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkA07G010230 · TK1151

Mitochondrion0.021

Rank 2 · TkA07G010230 · TK1151

Nucleus0.020

Rank 3 · TkA07G010230 · TK1151

Cytoplasm0.012

Rank 4 · TkA07G010230 · TK1151

Cell membrane0.009

Rank 5 · TkA07G010230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04483DUF565146-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G010230	`PF04483`	DUF565	146	204	1.5e-16	61.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80813`	Arabidopsis thaliana	sp\|O80813\|YC20L_ARATH Ycf20-like protein	45.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card