TkA07G009910 | RubberDandelionOmics

Gene overview

TkA07G009910

Reference: TK1151 Chr: Chr07 Coordinates: 2717716-2718968 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

742 bp · TkA07G009910|TK1151|cDNA

TCCCATTCTGGATTAGGGTTTCTCAGCCGTCCTCAGAGCGTCAGCAAGCAGCAGCTAATTCCCCACCGCCGTCGCCATGGGTCGTATGCACAGTGGAGGTAAGGGTATTTCGGCATCAGCTAAGCCGTACAAGAGGACTCCACCTAGCTGGCTGAAGATTTCATCTCAGGATGTCGAGGAGAACATTTGCAAGTTCGCCAAAAAGGGTCTTACACCATCTCAAATTGGTGTCATTCTTCGTGATTCTCACGGGATTGCGC...

CDS

Download CDS FASTA

456 bp · TkA07G009910|TK1151|CDS

ATGGGTCGTATGCACAGTGGAGGTAAGGGTATTTCGGCATCAGCTAAGCCGTACAAGAGGACTCCACCTAGCTGGCTGAAGATTTCATCTCAGGATGTCGAGGAGAACATTTGCAAGTTCGCCAAAAAGGGTCTTACACCATCTCAAATTGGTGTCATTCTTCGTGATTCTCACGGGATTGCGCAAGTGAACAGCGTAACCGGAAGCAAGATTCTCCGTATTTTGAAGGGCCACGGACTTGCTCCTGAAATCCCTGAGGA...

Protein

Download Protein FASTA

151 aa · TkA07G009910|TK1151|PROTEIN

MGRMHSGGKGISASAKPYKRTPPSWLKISSQDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKGHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G009910`
TK1151 ID	TkA07G009910
OH-1004 ID	LXL04_000680
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 99.338 / OH-1004 68.807 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G009910

Location Chr07:2717716-2718968 (-)

Description Similar to RPS13: 40S ribosomal protein S13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00100`	Small ribosomal subunit protein uS15y.	No verified direct reference in this release
`At3g60770`	Small ribosomal subunit protein uS15z.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0117300`	Small ribosomal subunit protein uS15y.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000680 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006412 translation Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G60770

ath:AT4G00100

dosa:Os08g0117300

gmx:100790163

gmx:547745

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.789

Rank 1 · TkA07G009910 · TK1151

Nucleus0.226

Rank 2 · TkA07G009910 · TK1151

Plastid0.113

Rank 3 · TkA07G009910 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA07G009910 · TK1151

Mitochondrion0.043

Rank 5 · TkA07G009910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08069Ribosomal_S13_N1-60 aa

PF09764Nt_Gln_amidase13-56 aa

PF00312Ribosomal_S1574-146 aa

PF09764Nt_Gln_amidase104-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G009910	`PF08069`	Ribosomal_S13_N	1	60	2.8e-31	108.1
TkA07G009910	`PF09764`	Nt_Gln_amidase	13	56	0.19	12.0
TkA07G009910	`PF00312`	Ribosomal_S15	74	146	2.6e-15	57.1
TkA07G009910	`PF09764`	Nt_Gln_amidase	104	140	0.19	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59224`	Arabidopsis thaliana	sp\|P59224\|RS132_ARATH Small ribosomal subunit protein uS15y	92.700%	Swiss-Prot	High
`P59223`	Arabidopsis thaliana	sp\|P59223\|RS131_ARATH Small ribosomal subunit protein uS15z	92.000%	Swiss-Prot	High
`Q69UI1`	Oryza sativa subsp. japonica	sp\|Q69UI1\|RS132_ORYSJ Small ribosomal subunit protein uS15y	86.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card