TkA07G009730 | RubberDandelionOmics

Gene overview

TkA07G009730

Reference: TK1151 Chr: Chr07 Coordinates: 2636402-2637055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

654 bp · TkA07G009730|TK1151|cDNA

ATGTTGGAGGATTTTAACGAAGAAAACAACCGAAAACACGCAATCAAACAATTCTCCTGTGTGATTCAAGGACTATGTAGAGTTAACGACTTTGAAGGGGCGAAAAACTTGTTGACCAAAATGATCAACGAAGGCCCTCCTCCCGGAAATGCAGTTTTCAACACCATCATAAACTCGTTATCCAAATCAGGAAACATGAAAGAAGCTATAGAGATAATGAGAGTAATGGAATCAAGAAACTTAAAGCCCGATGTGTTTAC...

CDS

Download CDS FASTA

654 bp · TkA07G009730|TK1151|CDS

ATGTTGGAGGATTTTAACGAAGAAAACAACCGAAAACACGCAATCAAACAATTCTCCTGTGTGATTCAAGGACTATGTAGAGTTAACGACTTTGAAGGGGCGAAAAACTTGTTGACCAAAATGATCAACGAAGGCCCTCCTCCCGGAAATGCAGTTTTCAACACCATCATAAACTCGTTATCCAAATCAGGAAACATGAAAGAAGCTATAGAGATAATGAGAGTAATGGAATCAAGAAACTTAAAGCCCGATGTGTTTAC...

Protein

Download Protein FASTA

217 aa · TkA07G009730|TK1151|PROTEIN

MLEDFNEENNRKHAIKQFSCVIQGLCRVNDFEGAKNLLTKMINEGPPPGNAVFNTIINSLSKSGNMKEAIEIMRVMESRNLKPDVFTYSVIMSGYAKGGEMGEAVKVLTEAKKSHCKLTPVTYHTMIRGYCKLEQFGKAIKLLNEMESFGVKPNGDEYNKLIQTVCLKAADWVMAEKLMEEMEKKGLCLNGITKSLVRAVKELEDEGRVKGTESEKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G009730`
TK1151 ID	TkA07G009730
OH-1004 ID	LXL04_026817
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.900
Protein coverage (%)	TK1151 98.618 / OH-1004 32.672 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G009730`
Location	Chr07:2636402-2637055 (-)
Description	Similar to At3g02650: Pentatricopeptide repeat-containing protein At3g02650, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026817` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0009737 response to abscisic acid Biological Process GO:0080156 mitochondrial mRNA modification Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005840 ribosome Cellular Component GO:0009507 chloroplast Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference	ath:AT3G02650 ath:AT4G11690 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.867

Rank 1 · TkA07G009730 · TK1151

Plastid0.066

Rank 2 · TkA07G009730 · TK1151

Nucleus0.061

Rank 3 · TkA07G009730 · TK1151

Cytoplasm0.037

Rank 4 · TkA07G009730 · TK1151

Cell membrane0.014

Rank 5 · TkA07G009730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17177PPR_long12-171 aa

PF13812PPR_315-59 aa

PF12921ATP1315-74 aa

PF23276TPR_2417-106 aa

PF28774DUF845717-41 aa

PF13762MNE117-100 aa

PF13041PPR_218-48 aa

PF12854PPR_118-41 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G009730	`PF17177`	PPR_long	12	171	1.4e-11	44.9
TkA07G009730	`PF13812`	PPR_3	15	59	3.9e-23	82.0
TkA07G009730	`PF12921`	ATP13	15	74	0.00011	22.8
TkA07G009730	`PF23276`	TPR_24	17	106	7.8e-14	52.4
TkA07G009730	`PF28774`	DUF8457	17	41	0.012	16.6
TkA07G009730	`PF13762`	MNE1	17	100	0.11	13.3
TkA07G009730	`PF13041`	PPR_2	18	48	5.8e-41	139.1
TkA07G009730	`PF12854`	PPR_1	18	41	3.6e-33	113.7
TkA07G009730	`PF01535`	PPR	18	45	4.7e-32	108.7
TkA07G009730	`PF24760`	TPR_IF140_C	18	41	3.1e-05	25.1
TkA07G009730	`PF26719`	TPR_Atp25_C	20	74	0.15	12.0
TkA07G009730	`PF29070`	MSC6_N	21	109	1.6e-09	38.1
TkA07G009730	`PF00637`	Clathrin	21	74	0.01	16.3
TkA07G009730	`PF14689`	SPOB_a	21	44	0.29	11.5
TkA07G009730	`PF13428`	TPR_14	25	46	0.24	12.9
TkA07G009730	`PF08542`	Rep_fac_C	26	68	0.00037	21.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card