TkA07G007880 | RubberDandelionOmics

Gene overview

TkA07G007880

Reference: TK1151 Chr: Chr07 Coordinates: 2201572-2203068 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · TkA07G007880|TK1151|cDNA

TCTTATTCTCTCCCCACCATTAGTACTTTCACCTCAAAAGAAACAAGTCCATTAGTCTTTGATGCTTCCATTCTTCAAAATGAAACTAATATCCCGTTACAGTTTGTGTGGCCGGACCATGAAAAGCCCTGCCTTGAATCACCACCATCTTTGCTTCATGTTCCTCCGATCGACCTAAAAGCCTTTATTTCCGGCGAGCCACTTGCAGCCTCCAGTGCAAGTCTTCTGGTCAATTCTGCATGCCAAGAACATGGCTTTTT...

CDS

Download CDS FASTA

1119 bp · TkA07G007880|TK1151|CDS

TCTTATTCTCTCCCCACCATTAGTACTTTCACCTCAAAAGAAACAAGTCCATTAGTCTTTGATGCTTCCATTCTTCAAAATGAAACTAATATCCCGTTACAGTTTGTGTGGCCGGACCATGAAAAGCCCTGCCTTGAATCACCACCATCTTTGCTTCATGTTCCTCCGATCGACCTAAAAGCCTTTATTTCCGGCGAGCCACTTGCAGCCTCCAGTGCAAGTCTTCTGGTCAATTCTGCATGCCAAGAACATGGCTTTTT...

Protein

Download Protein FASTA

372 aa · TkA07G007880|TK1151|PROTEIN

SYSLPTISTFTSKETSPLVFDASILQNETNIPLQFVWPDHEKPCLESPPSLLHVPPIDLKAFISGEPLAASSASLLVNSACQEHGFFQVFNHGVDSNLINEAHKMMDLFFGMPLLEKQKAERKFGEYCGYASSFTNRFSSKLPWKETLSFRYSADPKCSNVVQDYFMNVMGEDFSKFGRICQEYSEAMSKLSMNIMELLGMSLGIDPLYFRDFYEENDSIMRLNYYPPCQKPDQTLGTGPHCDPTSLTILHQDNVGGLEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G007880`
TK1151 ID	TkA07G007880
OH-1004 ID	LXL04_026792
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 97.043 / OH-1004 95.756 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G007880

Location Chr07:2201572-2203068 (+)

Description Similar to GA20OX2: Gibberellin 20 oxidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51810`	Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA12 to GA9, via a three-step oxidation at C-20 of the GA skeleton, and GA25 is also formed as a minor product.	The gibberellin biosynthetic genes AtGA20ox1 and AtGA20ox2 act, partially redundantly, to promote growth and development throughout the Arabidopsis life cycle.2008 · DOI: 10.1111/j.1365-313x.2007.03356.x Isolation and expression of three gibberellin 20-oxidase cDNA clones from Arabidopsis.1995 · DOI: 10.1104/pp.108.3.1049
`At4g25420`	Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA12 to GA9, via a three-step oxidation at C-20 of the GA skeleton.	The gibberellin biosynthetic genes AtGA20ox1 and AtGA20ox2 act, partially redundantly, to promote growth and development throughout the Arabidopsis life cycle.2008 · DOI: 10.1111/j.1365-313x.2007.03356.x Isolation and expression of three gibberellin 20-oxidase cDNA clones from Arabidopsis.1995 · DOI: 10.1104/pp.108.3.1049
`At5g07200`	May catalyze oxidation reactions in gibberellin biosynthesis.	Isolation and expression of three gibberellin 20-oxidase cDNA clones from Arabidopsis.1995 · DOI: 10.1104/pp.108.3.1049

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026792 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0048366 leaf development Biological Process

GO:0048575 short-day photoperiodism, flowering Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0045544 gibberellin 20-oxidase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G25420

ath:AT5G07200

ath:AT5G51810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.770

Rank 1 · TkA07G007880 · TK1151

Nucleus0.392

Rank 2 · TkA07G007880 · TK1151

Plastid0.053

Rank 3 · TkA07G007880 · TK1151

Peroxisome0.044

Rank 4 · TkA07G007880 · TK1151

Mitochondrion0.043

Rank 5 · TkA07G007880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N54-162 aa

PF031712OG-FeII_Oxy83-93 aa

PF031712OG-FeII_Oxy218-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G007880	`PF14226`	DIOX_N	54	162	9e-23	81.9
TkA07G007880	`PF03171`	2OG-FeII_Oxy	83	93	2.6e-36	124.7
TkA07G007880	`PF03171`	2OG-FeII_Oxy	218	316	2.6e-36	124.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39111`	Arabidopsis thaliana	sp\|Q39111\|GAOX2_ARATH Gibberellin 20 oxidase 2	61.800%	Swiss-Prot	High
`Q39110`	Arabidopsis thaliana	sp\|Q39110\|GAOX1_ARATH Gibberellin 20 oxidase 1	63.100%	Swiss-Prot	High
`Q39112`	Arabidopsis thaliana	sp\|Q39112\|GAOX3_ARATH Gibberellin 20 oxidase 3	61.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card