TkA07G007560 | RubberDandelionOmics

Gene overview

TkA07G007560

Reference: TK1151 Chr: Chr07 Coordinates: 2140068-2141648 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

739 bp · TkA07G007560|TK1151|cDNA

AAAAGAAAGAGCCCTAGAGAGTTGCAGAGCTACTAACCTTTTCAACAATGGCAGCAAGGGGAGGAGAAGGGCAAAGAAGAGGAGGAGGAGGAGGAAGACCTATGCCACCGTCGGCAAGAGGACCACCTGGCCCTCCTCTCCACGGTAAACCCGGACCTCGATTCGAACCAGTCGACCGCGAAAAGACTTGTCCATTGCTACTTCGAGTTTTCACCAAGATTGGTGGTCATCACAACCAGTCAGAATTTGCAGTTAGGGGA...

CDS

Download CDS FASTA

489 bp · TkA07G007560|TK1151|CDS

ATGGCAGCAAGGGGAGGAGAAGGGCAAAGAAGAGGAGGAGGAGGAGGAAGACCTATGCCACCGTCGGCAAGAGGACCACCTGGCCCTCCTCTCCACGGTAAACCCGGACCTCGATTCGAACCAGTCGACCGCGAAAAGACTTGTCCATTGCTACTTCGAGTTTTCACCAAGATTGGTGGTCATCACAACCAGTCAGAATTTGCAGTTAGGGGAAAAGAGCCTAAAGATGAAGTCCAAATATACACATGGATGGATGCTAC...

Protein

Download Protein FASTA

162 aa · TkA07G007560|TK1151|PROTEIN

MAARGGEGQRRGGGGGRPMPPSARGPPGPPLHGKPGPRFEPVDREKTCPLLLRVFTKIGGHHNQSEFAVRGKEPKDEVQIYTWMDATLRELTDLVKEVAPEARRRDAMLSFAFVYPTKTGHFAVKEVGKTLSYPNARRPDDGSKALGSLSFEIGDYLDVAIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G007560`
TK1151 ID	TkA07G007560
OH-1004 ID	LXL04_026791
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G007560

Location Chr07:2140068-2141648 (-)

Description Similar to At2g45640: Histone deacetylase complex subunit SAP18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45640`	Links the histone deacetylase complex to transcriptional repressors bound to chromatin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026791 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process

GO:0050684 regulation of mRNA processing Biological Process

GO:0000118 histone deacetylase complex Cellular Component

KEGG gene cross-reference

ath:AT2G45640

bta:615692

hsa:10284

mmu:20220

pon:100190849

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.675

Rank 1 · TkA07G007560 · TK1151

Cytoplasm0.219

Rank 2 · TkA07G007560 · TK1151

Endoplasmic reticulum0.144

Rank 3 · TkA07G007560 · TK1151

Cell membrane0.110

Rank 4 · TkA07G007560 · TK1151

Golgi apparatus0.054

Rank 5 · TkA07G007560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06487SAP1842-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G007560	`PF06487`	SAP18	42	161	2e-40	138.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64644`	Arabidopsis thaliana	sp\|O64644\|SAP18_ARATH Histone deacetylase complex subunit SAP18	69.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card