TkA07G007380 | RubberDandelionOmics

Gene overview

TkA07G007380

Reference: TK1151 Chr: Chr07 Coordinates: 2076851-2082974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3454 bp · TkA07G007380|TK1151|cDNA

GTTGTATCTTCATGTTTTTAACCATAAATCTTTATAAAATTAAGATATTCCAACATTTAAAATTCCGTTATAGGGAATCGTTATTTTCTTCCCTCATAAATTTCAAATTCTCCAAACATTTCCGCAATTTCCACAGATTAGCTACATTTCTCCACGTATAGCCCATAAAAAATCAAAACTTTTAACAAAAATGGTGAAGATCTTGCGTTATAATCGCAATCATTATCACCTAGGTTCTTTTTTCCCCAAATTTTCTTCCT...

CDS

Download CDS FASTA

2901 bp · TkA07G007380|TK1151|CDS

ATGGATAACAATTACAACCAATCATCTTCATACGACCCTAATTCTGCACCGTTTCCATCTCAACCTCCATACCCACCTCAAAATTCAGCTCCATATCCTCCATACCCGTACCCATATCCATACCAATCACAACCACCACCACCGCAGCCGCAATACCCTCCTCAACCCTACCCATATCAGTACCCCGGATACCCATACCCATACCCCACACTGGAACCTCAACTCAACACCCCAGAAAGTGGCGGTAGTGGCCCCACTTC...

Protein

Download Protein FASTA

966 aa · TkA07G007380|TK1151|PROTEIN

MDNNYNQSSSYDPNSAPFPSQPPYPPQNSAPYPPYPYPYPYQSQPPPPQPQYPPQPYPYQYPGYPYPYPTLEPQLNTPESGGSGPTSATNLPDEDNNSFVNENEPPGNPPGHHHSASYPSAYAPNLSGSLDSSQFLPVQPSASLDLASNQNYQIVPFAATPKKALKVLLLHGNLEICVHEAKNLPNMDVFQVFSKLPGKQTSDPYVSIAITSAVVGRTYVLNNVENPVWNQRFNVPVAHHTAEIHFLVKDKDVVGSQLIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G007380`
TK1151 ID	TkA07G007380
OH-1004 ID	LXL04_026786
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G007380

Location Chr07:2076851-2082974 (-)

Description Similar to PLDBETA1: Phospholipase D beta 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42010`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g00240`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g11850`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Expression and characterization of Arabidopsis phospholipase Dgamma2.2006 · DOI: 10.1016/j.bbalip.2006.09.017
`At4g11840`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g11830`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Expression and characterization of Arabidopsis phospholipase Dgamma2.2006 · DOI: 10.1016/j.bbalip.2006.09.017

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026786 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006643 membrane lipid metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009395 phospholipid catabolic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046470 phosphatidylcholine metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G42010

ath:AT4G00240

ath:AT4G11830

ath:AT4G11840

ath:AT4G11850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.487

Rank 1 · TkA07G007380 · TK1151

Cell membrane0.296

Rank 2 · TkA07G007380 · TK1151

Nucleus0.245

Rank 3 · TkA07G007380 · TK1151

Lysosome / Vacuole0.130

Rank 4 · TkA07G007380 · TK1151

Golgi apparatus0.116

Rank 5 · TkA07G007380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C2172-280 aa

PF00614PLDc372-955 aa

PF13091PLDc_2406-495 aa

PF13091PLDc_2667-690 aa

PF00168C2810-839 aa

PF13091PLDc_2814-850 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G007380	`PF00168`	C2	172	280	5.2e-18	65.9
TkA07G007380	`PF00614`	PLDc	372	955	5.2e-228	758.6
TkA07G007380	`PF13091`	PLDc_2	406	495	3.2e-09	37.4
TkA07G007380	`PF13091`	PLDc_2	667	690	3.2e-09	37.4
TkA07G007380	`PF00168`	C2	810	839	5.2e-18	65.9
TkA07G007380	`PF13091`	PLDc_2	814	850	3.2e-09	37.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93733`	Arabidopsis thaliana	sp\|P93733\|PLDB1_ARATH Phospholipase D beta 1	69.600%	Swiss-Prot	High
`O23078`	Arabidopsis thaliana	sp\|O23078\|PLDB2_ARATH Phospholipase D beta 2	69.800%	Swiss-Prot	High
`Q9T053`	Arabidopsis thaliana	sp\|Q9T053\|PLDG1_ARATH Phospholipase D gamma 1	65.300%	Swiss-Prot	High
`Q9T052`	Arabidopsis thaliana	sp\|Q9T052\|PLDG3_ARATH Phospholipase D gamma 3	64.500%	Swiss-Prot	High
`Q9T051`	Arabidopsis thaliana	sp\|Q9T051\|PLDG2_ARATH Phospholipase D gamma 2	62.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card