TkA07G006570 | RubberDandelionOmics

Gene overview

TkA07G006570

Reference: TK1151 Chr: Chr07 Coordinates: 1826925-1829668 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1434 bp · TkA07G006570|TK1151|cDNA

ATGCTTGATATGCTTGATCGATGTCGTTATGAAGTTTTTAACTACCAAACAGAAATGGATTCAATGAAAATAATCCGGGAGAAGAAAGATGATTTGGAACTAATAATGACAAATGTTCATCGAACATATGCAAACAAATTTGGGATCATGGAACAAATAGAAAAGGAATTGAAACTCCAAATCATTTTGATGTCACCAGATGTTGATAATATAAAGAAGGTTTCAGAGAGTGGTGGTAATGGTGTAAGTGTATATATTTT...

CDS

Download CDS FASTA

1434 bp · TkA07G006570|TK1151|CDS

ATGCTTGATATGCTTGATCGATGTCGTTATGAAGTTTTTAACTACCAAACAGAAATGGATTCAATGAAAATAATCCGGGAGAAGAAAGATGATTTGGAACTAATAATGACAAATGTTCATCGAACATATGCAAACAAATTTGGGATCATGGAACAAATAGAAAAGGAATTGAAACTCCAAATCATTTTGATGTCACCAGATGTTGATAATATAAAGAAGGTTTCAGAGAGTGGTGGTAATGGTGTAAGTGTATATATTTT...

Protein

Download Protein FASTA

477 aa · TkA07G006570|TK1151|PROTEIN

MLDMLDRCRYEVFNYQTEMDSMKIIREKKDDLELIMTNVHRTYANKFGIMEQIEKELKLQIILMSPDVDNIKKVSESGGNGVSVYILKSSSVNEVNNLWATAMKKEKEKGKMETSSGKSGVKRKLNIDEENGNVEKKPRIVWSKEMHQKFLEAVDQLGHDKAFPKKIVELMNVPGLTRENVASHLQKYRMCMKRAQEGFTSSSYDFNNSFAFSTIEPNSQESHWNPFRIRSRNTTSDATSTSLFGLNFHESRSRTFPNMP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G006570`
TK1151 ID	TkA07G006570
OH-1004 ID	LXL04_026768
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 92.996 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G006570

Location Chr07:1826925-1829668 (-)

Description Similar to ARR2: Two-component response regulator ARR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31920`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500
`At1g67710`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.2003 · DOI: 10.1093/pcp/pcg014

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0904700`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`UniProt: B8B3I4`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`Os06g0183100`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026768 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT3G16857

ath:AT4G16110

dosa:Os01g0904700

dosa:Os06g0183100

osa:4325022

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkA07G006570 · TK1151

Cytoplasm0.097

Rank 2 · TkA07G006570 · TK1151

Cell membrane0.024

Rank 3 · TkA07G006570 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA07G006570 · TK1151

Plastid0.010

Rank 5 · TkA07G006570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17528HdcB20-57 aa

PF25533Lysostaphin_N64-144 aa

PF17528HdcB76-144 aa

PF07638Sigma70_ECF108-190 aa

PF00249Myb_DNA-binding142-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G006570	`PF17528`	HdcB	20	57	0.65	10.5
TkA07G006570	`PF25533`	Lysostaphin_N	64	144	0.16	12.7
TkA07G006570	`PF17528`	HdcB	76	144	0.65	10.5
TkA07G006570	`PF07638`	Sigma70_ECF	108	190	0.14	12.7
TkA07G006570	`PF00249`	Myb_DNA-binding	142	189	2.5e-07	31.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49397`	Arabidopsis thaliana	sp\|O49397\|ARR10_ARATH Two-component response regulator ARR10	34.800%	Swiss-Prot	Low
`Q9FXD6`	Arabidopsis thaliana	sp\|Q9FXD6\|ARR11_ARATH Two-component response regulator ARR11	34.200%	Swiss-Prot	Low
`Q5N6V8`	Oryza sativa subsp. japonica	sp\|Q5N6V8\|ORR26_ORYSJ Two-component response regulator ORR26	33.600%	Swiss-Prot	Low
`B8B3I4`	Oryza sativa subsp. indica	sp\|B8B3I4\|ORR22_ORYSI Two-component response regulator ORR22	34.100%	Swiss-Prot	Low
`Q5SML5`	Oryza sativa subsp. japonica	sp\|Q5SML5\|ORR22_ORYSJ Two-component response regulator ORR22	34.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card