TkA07G005650 | RubberDandelionOmics

Gene overview

TkA07G005650

Reference: TK1151 Chr: Chr07 Coordinates: 1581293-1583627 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

747 bp · TkA07G005650|TK1151|cDNA

ATGGCTTCCAAGATGTCGTCTCGGTCAAGAGGAGGCGCCTCTGTAAAAGCCAATTCCAGAGAAACCGGCCCCAAGCTCGAGGAGAATCTTAACATCTTCAATTCCGATATATTCGACGCCGATGCCTTTGTCAACTCCAAGTGTAATTCCTTGAACGAGAAGGTCGCTGACGAAAGAGGACTTCGTTTTTGTATGAACAACTGGCATAAGAGAGTTGCTTACTTGGATACTGATGTTGGACAACCCGAGTTTACCCCTCC...

CDS

Download CDS FASTA

747 bp · TkA07G005650|TK1151|CDS

ATGGCTTCCAAGATGTCGTCTCGGTCAAGAGGAGGCGCCTCTGTAAAAGCCAATTCCAGAGAAACCGGCCCCAAGCTCGAGGAGAATCTTAACATCTTCAATTCCGATATATTCGACGCCGATGCCTTTGTCAACTCCAAGTGTAATTCCTTGAACGAGAAGGTCGCTGACGAAAGAGGACTTCGTTTTTGTATGAACAACTGGCATAAGAGAGTTGCTTACTTGGATACTGATGTTGGACAACCCGAGTTTACCCCTCC...

Protein

Download Protein FASTA

248 aa · TkA07G005650|TK1151|PROTEIN

MASKMSSRSRGGASVKANSRETGPKLEENLNIFNSDIFDADAFVNSKCNSLNEKVADERGLRFCMNNWHKRVAYLDTDVGQPEFTPPGCLSLTLVDIETIGIVFLRFDIMKSSATIAEAYAYYAFEFPLFRSSLLMCCHFSILGFSLNAIIHHRTISHITSVYILSSHASSSAFLFSRGIEYVVANIKLSVKAPKLPHYLFLYYMHPILQGVIMVLLISIKQVCYGLDSVANVFRSEFHSKFAMDLIP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G005650`
TK1151 ID	TkA07G005650
OH-1004 ID	LXL04_023323
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.900
Protein coverage (%)	TK1151 89.113 / OH-1004 93.676 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G005650

Location Chr07:1581293-1583627 (+)

Description Similar to At5g11010: Polynucleotide 5'-hydroxyl-kinase NOL9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11010`	Polynucleotide 5'-kinase involved in rRNA processing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023323 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006364 rRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0051731 polynucleotide 5'-hydroxyl-kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G11010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.256

Rank 1 · TkA07G005650 · TK1151

Nucleus0.210

Rank 2 · TkA07G005650 · TK1151

Mitochondrion0.180

Rank 3 · TkA07G005650 · TK1151

Cytoplasm0.169

Rank 4 · TkA07G005650 · TK1151

Cell membrane0.128

Rank 5 · TkA07G005650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16575CLP1_P69-96 aa

PF26716PIAL1_N157-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G005650	`PF16575`	CLP1_P	69	96	1.4e-07	32.2
TkA07G005650	`PF26716`	PIAL1_N	157	224	2.7e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYP6`	Arabidopsis thaliana	sp\|Q8VYP6\|NOL9_ARATH Polynucleotide 5'-hydroxyl-kinase NOL9	85.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card