RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G005570
Reference: TK1151 Chr: Chr07 Coordinates: 1542442-1547154 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1105 bp · TkA07G005570|TK1151|cDNA

GATTTTGAATCAACTCTTGTAAATGGTAATGGTACCGAAACAGTCTACAGGATGTCAAGGCATTATGTTAGGATGAATCAACACATGCCTATGTTGTATGTACAGCTCTACACATATCAGATCTGTCGTTCACTTAACTACATTCATAATGTGATTGGTGTATGCCATCGTGATATCAAGCCACAAAATTTATTGGTTAATCCACAAACTCATCAGCTAAAGCTATGTGATTTTGGGAGTGCAAAGATGCTGGTACCTGG...

CDS

Download CDS FASTA

1320 bp · TkA07G005570|TK1151|CDS

ATGAATGTGATGCGTCGTTTGAAGAGTATCGCCTCTGGTCGTACTTCTGTTTCGGATACCGGTGGGGATTCCAACAAATCTGGGAGTATGGAGCAGCCTGGAAGTGCTAGATCTGTAAAGATGTCGACCAGCACATCTTTTGCCAGACATGGAAAATCTGACCTTGATAAACTCCCAAAAGAAATGAACGGAATGAAAATTCTGGAAGATAAAACTGATGAAAAGGATTTTGAATCAACTCTTGTAAATGGTAATGGTAC...

Protein

Download Protein FASTA

439 aa · TkA07G005570|TK1151|PROTEIN

MNVMRRLKSIASGRTSVSDTGGDSNKSGSMEQPGSARSVKMSTSTSFARHGKSDLDKLPKEMNGMKILEDKTDEKDFESTLVNGNGTETGQIIVTSIGGKNGKPKQTLSYIAERVVGTGSFGVVFQAKCLETGESVAIKKVLQDKRYKNRELQIMRLLQHPNVVPLKNCFYSTTEKNEVYLNVVLEFVPETVYRMSRHYVRMNQHMPMLYVQLYTYQICRSLNYIHNVIGVCHRDIKPQNLLVNPQTHQLKLCDFGSAKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G005570
TK1151 IDTkA07G005570
OH-1004 IDLXL04_026750
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G005570
LocationChr07:1542442-1547154 (-)
DescriptionSimilar to ASK8: Shaggy-related protein kinase theta
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g00720 May mediate extracellular signals to regulate transcription in differentiating cells. No verified direct reference in this release
At5g14640 May mediate extracellular signals to regulate transcription in differentiating cells. No verified direct reference in this release
At5g26751 May mediate extracellular signals to regulate transcription in differentiating cells. No verified direct reference in this release
At3g05840 May mediate extracellular signals to regulate transcription in differentiating cells. No verified direct reference in this release
At1g57870 May mediate extracellular signals to regulate transcription in differentiating cells. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006972 hyperosmotic response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0030154 cell differentiation Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0016301 kinase activity Molecular Function
KEGG gene cross-reference
ath:AT4G00720
ath:AT5G14640
bna:106388722
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.667
Rank 1 · TkA07G005570 · TK1151
Nucleus0.381
Rank 2 · TkA07G005570 · TK1151
Cell membrane0.108
Rank 3 · TkA07G005570 · TK1151
Mitochondrion0.047
Rank 4 · TkA07G005570 · TK1151
Golgi apparatus0.032
Rank 5 · TkA07G005570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC1102-143 aa
PF14531Kinase-like110-153 aa
PF00069Pkinase111-394 aa
PF07714PK_Tyr_Ser-Thr113-311 aa
PF01636APH149-194 aa
PF05445Pox_ser-thr_kin187-252 aa
PF01633Choline_kinase199-256 aa
PF14531Kinase-like212-284 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G005570PF03109ABC11021437.7e-0626.0
TkA07G005570PF14531Kinase-like1101530.03114.3
TkA07G005570PF00069Pkinase1113941.4e-61208.9
TkA07G005570PF07714PK_Tyr_Ser-Thr1133112.1e-2383.7
TkA07G005570PF01636APH1491940.2511.8
TkA07G005570PF05445Pox_ser-thr_kin1872520.05613.1
TkA07G005570PF01633Choline_kinase1992560.001818.3
TkA07G005570PF14531Kinase-like2122840.03114.3
TkA07G005570PF03109ABC12222617.7e-0626.0
TkA07G005570PF01636APH2302570.2511.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q96287Arabidopsis thalianasp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta72.600%Swiss-ProtHigh
Q8VZD5Arabidopsis thalianasp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon76.100%Swiss-ProtHigh
P43288Arabidopsis thalianasp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha82.000%Swiss-ProtHigh
P43289Arabidopsis thalianasp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma81.700%Swiss-ProtHigh
Q9FVS6Arabidopsis thalianasp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta79.000%Swiss-ProtHigh

JBrowse

View in Genome Browser