TkA07G004830 | RubberDandelionOmics

Gene overview

TkA07G004830

Reference: TK1151 Chr: Chr07 Coordinates: 1315480-1323522 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1855 bp · TkA07G004830|TK1151|cDNA

AATCTATGCTCTTTTACCTGAAATTATACATTGCATACATCCTGAGAAAAGTTGTCACTTGAAAAAATGTACCAAGAGAATAGCTCCTAATTTATTCCCTTTTATTGACACTTGAGATTATCATTTGCACACAGCACAATTCACATGTTTCATGCTGCAAATTAAACTTTAAAAGTGGCATGATGACTACCTCCTGAGTTTTTCAAAGCTTCCATGGCAGATTTAAAGGAGGTTGATGTTGGTGCTGACGGTGGTTCTGC...

CDS

Download CDS FASTA

1437 bp · TkA07G004830|TK1151|CDS

ATGGCAGATTTAAAGGAGGTTGATGTTGGTGCTGACGGTGGTTCTGCATCTCCAACCACCACAAACCGGAAACATGCAAACATCTCAGGCATGATTGTCAAGAATCCCGGCGTACCCATATTTCTTTCCGTGTTTTTAGTCACCCTTTTCATCACTGCAGCTTTATTCACTCGTTGGGTTGATGTTTCTATCATAACAGCTCGATTTCATCAAAAAGATATCCTTCCCTTTGAAGACGATGAAACTACCAATAATTCAAC...

Protein

Download Protein FASTA

478 aa · TkA07G004830|TK1151|PROTEIN

MADLKEVDVGADGGSASPTTTNRKHANISGMIVKNPGVPIFLSVFLVTLFITAALFTRWVDVSIITARFHQKDILPFEDDETTNNSTSESCPEYFRWIHEDLKPWKNTGITKEMVEKAREKAHFRLIIVDGRLYMEKYNYVFQTRDVFTIWGILQLLKLYPGKFPDLDLMFMCHDWPLIRKADYRDNNTVIPPLFHYCGDDLTYDIVFPDWSFWGWPEVNVKPWVNLTKELEQGNKKKRWKDREPYAYWKGNTYTGKARR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G004830`
TK1151 ID	TkA07G004830
OH-1004 ID	LXL04_026739
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G004830`
Location	Chr07:1315480-1323522 (+)
Description	Similar to POGLUT1: Protein O-glucosyltransferase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026739` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006493 protein O-linked glycosylation Biological Process GO:0007219 Notch signaling pathway Biological Process GO:0008593 regulation of Notch signaling pathway Biological Process GO:0045165 cell fate commitment Biological Process GO:0045746 negative regulation of Notch signaling pathway Biological Process GO:0045747 positive regulation of Notch signaling pathway Biological Process GO:0180059 protein O-linked glycosylation via glucose Biological Process GO:0180064 protein O-linked glycosylation via xylose Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005788 endoplasmic reticulum lumen Cellular Component GO:0012505 endomembrane system Cellular Component GO:0035251 UDP-glucosyltransferase activity Molecular Function
KEGG gene cross-reference	bta:511862 dme:Dmel_CG31152 dpo:4800928 hsa:56983 mmu:224143 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.769

Rank 1 · TkA07G004830 · TK1151

Endoplasmic reticulum0.131

Rank 2 · TkA07G004830 · TK1151

Cytoplasm0.062

Rank 3 · TkA07G004830 · TK1151

Cell membrane0.045

Rank 4 · TkA07G004830 · TK1151

Extracellular0.045

Rank 5 · TkA07G004830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05686Glyco_transf_9087-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G004830	`PF05686`	Glyco_transf_90	87	473	1.9e-170	567.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card