TkA07G004580 | RubberDandelionOmics

Gene overview

TkA07G004580

Reference: TK1151 Chr: Chr07 Coordinates: 1227033-1228003 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

653 bp · TkA07G004580|TK1151|cDNA

TTAAAGCAACCAACGTTAACGCTCTCAAAAGGCTTTCTAAATTTCAAAATTTCAAACTTTCCCAAAACCCTAACCACTAAATTCCCCCTATCTTCTGCACAATCCCGACCTGATTCAGTTTCATCTAAACTCCGTCATCCGAGTCATCACCGGAGCTCCGAATTTCTAAAATTGGAGATGACGGAGCAGCGTCAACTTGAAGGAGAAGCTCCAGATCAGGTCACCGATGAAATTGAGGAGGAGGTTGATCAATTAGAGGA...

CDS

Download CDS FASTA

630 bp · TkA07G004580|TK1151|CDS

TTAAAGCAACCAACGTTAACGCTCTCAAAAGGCTTTCTAAATTTCAAAATTTCAAACTTTCCCAAAACCCTAACCACTAAATTCCCCCTATCTTCTGCACAATCCCGACCTGATTCAGTTTCATCTAAACTCCGTCATCCGAGTCATCACCGGAGCTCCGAATTTCTAAAATTGGAGATGACGGAGCAGCGTCAACTTGAAGGAGAAGCTCCAGATCAGGTCACCGATGAAATTGAGGAGGAGGTTGATCAATTAGAGGA...

Protein

Download Protein FASTA

209 aa · TkA07G004580|TK1151|PROTEIN

LKQPTLTLSKGFLNFKISNFPKTLTTKFPLSSAQSRPDSVSSKLRHPSHHRSSEFLKLEMTEQRQLEGEAPDQVTDEIEEEVDQLEEDVSLMAQKIAEFRETLPEQLQNTLASILSAQRPVILNHDSDNDPGPSSNANQETVELVQDDVAHTEKIQTIKEKISSNNFAMSLVLKRMKDCMSRIEKLESFNKGTIIHRAFKRRRMQDCFM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G004580`
TK1151 ID	TkA07G004580
OH-1004 ID	LXL04_022651
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.500
Protein coverage (%)	TK1151 58.852 / OH-1004 87.413 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G004580`
Location	Chr07:1227033-1228003 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022651` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.912

Rank 1 · TkA07G004580 · TK1151

Cytoplasm0.193

Rank 2 · TkA07G004580 · TK1151

Cell membrane0.024

Rank 3 · TkA07G004580 · TK1151

Mitochondrion0.020

Rank 4 · TkA07G004580 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA07G004580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23984DUF730714-45 aa

PF07073ROF56-100 aa

PF16326ABC_tran_CTD57-99 aa

PF23203KIF21A61-102 aa

PF20379DUF667464-112 aa

PF08702Fib_alpha68-108 aa

PF27405Lin0124_C70-113 aa

PF07889DUF166470-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G004580	`PF23984`	DUF7307	14	45	0.22	12.2
TkA07G004580	`PF07073`	ROF	56	100	0.18	12.7
TkA07G004580	`PF16326`	ABC_tran_CTD	57	99	7.6	7.5
TkA07G004580	`PF23203`	KIF21A	61	102	0.092	13.2
TkA07G004580	`PF20379`	DUF6674	64	112	0.11	12.8
TkA07G004580	`PF08702`	Fib_alpha	68	108	0.93	10.4
TkA07G004580	`PF27405`	Lin0124_C	70	113	0.3	12.0
TkA07G004580	`PF07889`	DUF1664	70	117	0.61	10.9
TkA07G004580	`PF29876`	VAB2	71	115	0.037	14.7
TkA07G004580	`PF20140`	DUF6530	71	116	0.54	10.8
TkA07G004580	`PF05524`	PEP-utilisers_N	72	119	0.59	11.0
TkA07G004580	`PF10779`	XhlA	75	104	0.13	13.2
TkA07G004580	`PF01519`	DUF16	76	108	0.091	14.0
TkA07G004580	`PF23984`	DUF7307	76	109	0.22	12.2
TkA07G004580	`PF05377`	FlaC_arch	76	110	2.5	9.3
TkA07G004580	`PF06825`	HSBP1	76	90	4.5	7.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card