TkA07G004420 | RubberDandelionOmics

Gene overview

TkA07G004420

Reference: TK1151 Chr: Chr07 Coordinates: 1162319-1168585 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4130 bp · TkA07G004420|TK1151|cDNA

AGGGAAATAACAATTAAACAAATAACTAAAAAACAGCAAGGACCACTCCCACATTCACCTTCTAAAAAGGTGCATCCCAACATTGTTTGGTCAAATTTTCTCCCCCTACCCCCTCCCCCTCAAACACACACACAATGTGTAAGAGTGTAAGAGAAACGACAGAGTTTTGGTGGGGGGAGGTGGTAACATTGATGACATGAGGGAAAAAAACTGCAGATGAAGAAAAACAATGGAAACTTTTGTTCAAAGCTTTCTCTTTC...

CDS

Download CDS FASTA

2316 bp · TkA07G004420|TK1151|CDS

ATGGCGAAAAAATCAAAACAACGTCCTGTTAGACAAAAGAAAGATCAATCGGGTTGTATGTGGGGATTAATTAGTATGTTTGACTTCCGACATGGTCGCACCACAAAAAGACTGCTTTCAGATCGAAGAAGATATGCTGCCACTAATACTAATGATTCTCCATATGTTTCATCTGGAGCAAATTTGCCTACAAATTCTGAAGAAATGCATGTAACCATTGAGAAACCCGGACTTGATCTCGTGAGGTCAAGAGTTAAGGA...

Protein

Download Protein FASTA

771 aa · TkA07G004420|TK1151|PROTEIN

MAKKSKQRPVRQKKDQSGCMWGLISMFDFRHGRTTKRLLSDRRRYAATNTNDSPYVSSGANLPTNSEEMHVTIEKPGLDLVRSRVKELIEEEMFIDKDSKKQNDTTILKNHKNKHSEKTKTLKESFDHEITVTHTQKTSQYHDLEALVKEILLIYQKKNEQHGDLETGAKQSFPIVEEKKLVAAIETLLNENKKFHHSREMFQMLSSNKELFFKLIQDQNTILQKEDQKSKSKSIADSNISEIDQTAQESEESMTRKHRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G004420`
TK1151 ID	TkA07G004420
OH-1004 ID	LXL04_026726
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G004420`
Location	Chr07:1162319-1168585 (+)
Description	Similar to TRM32: Protein TRM32
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026726` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT1G07620 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.415

Rank 1 · TkA07G004420 · TK1151

Cytoplasm0.410

Rank 2 · TkA07G004420 · TK1151

Nucleus0.338

Rank 3 · TkA07G004420 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA07G004420 · TK1151

Plastid0.042

Rank 5 · TkA07G004420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25026Asd-479-127 aa

PF12552DUF3741109-124 aa

PF12552DUF3741189-222 aa

PF14309DUF4378208-246 aa

PF25026Asd-4242-254 aa

PF12552DUF3741243-254 aa

PF25026Asd-4357-397 aa

PF14309DUF4378609-754 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G004420	`PF25026`	Asd-4	79	127	2.0	9.3
TkA07G004420	`PF12552`	DUF3741	109	124	8.3e-06	26.7
TkA07G004420	`PF12552`	DUF3741	189	222	8.3e-06	26.7
TkA07G004420	`PF14309`	DUF4378	208	246	3.5e-26	93.2
TkA07G004420	`PF25026`	Asd-4	242	254	2.0	9.3
TkA07G004420	`PF12552`	DUF3741	243	254	8.3e-06	26.7
TkA07G004420	`PF25026`	Asd-4	357	397	2.0	9.3
TkA07G004420	`PF14309`	DUF4378	609	754	3.5e-26	93.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card