TkA07G002820 | RubberDandelionOmics

Gene overview

TkA07G002820

Reference: TK1151 Chr: Chr07 Coordinates: 740427-747687 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2323 bp · TkA07G002820|TK1151|cDNA

AGAAAACCTAAAGATAGAGAGAATGAAGATAATCAAAGGGCTTGTGATGGTGGTGTTTGTAGGATACCTTTTCCTATGGGTGATGACACCAACCTACGTTTTTAAGCAAAAGTGGCTCGTTAGGGTTCGAGCCCACACCAGTTCTACTTACTTTGGAAAACAAGGTCCGACGATGTTGCTCTATACATTTCCAGTTTTGTTCATGGCTGTCATGGGGAGTGTATATCTCCATTTAAGGAAAATGTCGAACCAAAATCGTG...

CDS

Download CDS FASTA

858 bp · TkA07G002820|TK1151|CDS

ATGAAGATAATCAAAGGGCTTGTGATGGTGGTGTTTGTAGGATACCTTTTCCTATGGGTGATGACACCAACCTACGTTTTTAAGCAAAAGTGGCTCGTTAGGGTTCGAGCCCACACCAGTTCTACTTACTTTGGAAAACAAGGTCCGACGATGTTGCTCTATACATTTCCAGTTTTGTTCATGGCTGTCATGGGGAGTGTATATCTCCATTTAAGGAAAATGTCGAACCAAAATCGTGATGAAGGACGAAAAGAAGTTAC...

Protein

Download Protein FASTA

285 aa · TkA07G002820|TK1151|PROTEIN

MKIIKGLVMVVFVGYLFLWVMTPTYVFKQKWLVRVRAHTSSTYFGKQGPTMLLYTFPVLFMAVMGSVYLHLRKMSNQNRDEGRKEVTNYNLAIWRRPMIVKSLGIVSKIELAFFIMFIALLVWSFTTYIHVSFAKITPQSAAKKGEEVWESKLDSVALRFGLIGNICLAFLFFPVTRSSSILPLFGLTSEASVKYHIWLGHIMMTLFSSHGVCYIIYWILTNQTSEMLKWARIGISNVAGELSLLSGLVMWAQLFLKLGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G002820`
TK1151 ID	TkA07G002820
OH-1004 ID	LXL04_026706
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 89.474 / OH-1004 36.533 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G002820

Location Chr07:740427-747687 (+)

Description Similar to FRO2: Ferric reduction oxidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23020`	Ferric chelate reductase involved in iron reduction in roots.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163
`At1g01580`	Flavocytochrome that transfers electrons across the plasma membrane to reduce ferric iron chelates to form soluble ferrous iron in the rhizosphere.	A ferric-chelate reductase for iron uptake from soils.1999 · DOI: 10.1038/17800 Overexpression of the FRO2 ferric chelate reductase confers tolerance to growth on low iron and uncovers posttranscriptional control.2003 · DOI: 10.1104/pp.103.025122 Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 The FRO2 ferric reductase is required for glycine betaine's effect on chilling tolerance in Arabidopsis roots.2008 · DOI: 10.1111/j.1399-3054.2008.01141.x
`At1g01590`	Ferric chelate reductase involved in iron reduction in roots (By similarity).	No verified direct reference in this release
`At5g23980`	Ferric chelate reductase.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 Transcriptome sequencing identifies SPL7-regulated copper acquisition genes FRO4/FRO5 and the copper dependence of iron homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.111.090431
`At5g23990`	Ferric chelate reductase probably involved in iron reduction in shoots.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 Transcriptome sequencing identifies SPL7-regulated copper acquisition genes FRO4/FRO5 and the copper dependence of iron homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.111.090431

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026706 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0033212 iron import into cell Biological Process

GO:0033214 siderophore-iron import into cell Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0140618 ferric-chelate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G01580

ath:AT1G01590

ath:AT1G23020

ath:AT5G23980

ath:AT5G23990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.599

Rank 1 · TkA07G002820 · TK1151

Endoplasmic reticulum0.189

Rank 2 · TkA07G002820 · TK1151

Lysosome / Vacuole0.098

Rank 3 · TkA07G002820 · TK1151

Cytoplasm0.072

Rank 4 · TkA07G002820 · TK1151

Golgi apparatus0.067

Rank 5 · TkA07G002820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13314DUF40837-15 aa

PF12823DUF381710-22 aa

PF01794Ferric_reduct13-24 aa

PF26247DUF805839-80 aa

PF10066DUF230447-78 aa

PF13314DUF408358-79 aa

PF10066DUF2304101-132 aa

PF26247DUF8058108-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G002820	`PF13314`	DUF4083	7	15	3.4	8.4
TkA07G002820	`PF12823`	DUF3817	10	22	0.052	15.0
TkA07G002820	`PF01794`	Ferric_reduct	13	24	1.9e-11	44.8
TkA07G002820	`PF26247`	DUF8058	39	80	0.63	10.6
TkA07G002820	`PF10066`	DUF2304	47	78	0.13	13.2
TkA07G002820	`PF13314`	DUF4083	58	79	3.4	8.4
TkA07G002820	`PF10066`	DUF2304	101	132	0.13	13.2
TkA07G002820	`PF26247`	DUF8058	108	128	0.63	10.6
TkA07G002820	`PF01794`	Ferric_reduct	113	121	1.9e-11	44.8
TkA07G002820	`PF13314`	DUF4083	115	156	3.4	8.4
TkA07G002820	`PF12823`	DUF3817	116	125	0.052	15.0
TkA07G002820	`PF01794`	Ferric_reduct	160	253	1.9e-11	44.8
TkA07G002820	`PF13314`	DUF4083	160	173	3.4	8.4
TkA07G002820	`PF10066`	DUF2304	163	208	0.13	13.2
TkA07G002820	`PF12823`	DUF3817	185	232	0.052	15.0
TkA07G002820	`PF10066`	DUF2304	206	231	0.13	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I4K7`	Arabidopsis thaliana	sp\|F4I4K7\|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial	50.600%	Swiss-Prot	High
`P92949`	Arabidopsis thaliana	sp\|P92949\|FRO2_ARATH Ferric reduction oxidase 2	51.000%	Swiss-Prot	High
`Q9LMM2`	Arabidopsis thaliana	sp\|Q9LMM2\|FRO1_ARATH Probable ferric reduction oxidase 1	46.800%	Swiss-Prot	Medium
`Q8W110`	Arabidopsis thaliana	sp\|Q8W110\|FRO4_ARATH Ferric reduction oxidase 4	40.600%	Swiss-Prot	Medium
`Q9FLW2`	Arabidopsis thaliana	sp\|Q9FLW2\|FRO5_ARATH Ferric reduction oxidase 5	38.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card