TkA06G480290 | RubberDandelionOmics

Gene overview

TkA06G480290

Reference: TK1151 Chr: Chr06 Coordinates: 119031513-119033593 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

882 bp · TkA06G480290|TK1151|cDNA

ATGAAGGACGTCGATTTTAGCCGGGACAAAGATCTGGCGAAGGATTTTCTACAAAACTTTGCCGATGCAGAGGGCGAAGCGAAATATATCAGCATCCTTTACAAGGATTTGGACGAGGAGTTTGTGGGACGAGTTAACGAGAACACCCGAAGATATGTTGGCGTTTTTGCCGATGCCATTGATGAGTTGATCCCTCAGCCAACGGAGGCTTTTCAGGACGACGATCTTGACATATTGATGACACAAAGAGCCGAGGAAGG...

CDS

Download CDS FASTA

882 bp · TkA06G480290|TK1151|CDS

ATGAAGGACGTCGATTTTAGCCGGGACAAAGATCTGGCGAAGGATTTTCTACAAAACTTTGCCGATGCAGAGGGCGAAGCGAAATATATCAGCATCCTTTACAAGGATTTGGACGAGGAGTTTGTGGGACGAGTTAACGAGAACACCCGAAGATATGTTGGCGTTTTTGCCGATGCCATTGATGAGTTGATCCCTCAGCCAACGGAGGCTTTTCAGGACGACGATCTTGACATATTGATGACACAAAGAGCCGAGGAAGG...

Protein

Download Protein FASTA

293 aa · TkA06G480290|TK1151|PROTEIN

MKDVDFSRDKDLAKDFLQNFADAEGEAKYISILYKDLDEEFVGRVNENTRRYVGVFADAIDELIPQPTEAFQDDDLDILMTQRAEEGNDNADGTNPIFFMKYLDGKGEEYLCGLPLKPPKVVNSRHYKSVIGFQTFFRQLHDELLLVSGQQEHVVLADKVVVGMSTVLIFVPGEVRNTFRSAGKGYKYENPENFSSFEEEAHYTKLGQGLHCNFKPFLTLPFVLGAVGREVKQGKELAPGNTSGKAVQAKNGNLHKSRAH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G480290`
TK1151 ID	TkA06G480290
OH-1004 ID	LXL04_022527
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.100
Protein coverage (%)	TK1151 85.324 / OH-1004 23.446 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G480290

Location Chr06:119031513-119033593 (-)

Description Similar to VPS51: Vacuolar protein sorting-associated protein 51 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02060`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BMI1`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release
`Os12g0560700`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022527 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006271 DNA strand elongation involved in DNA replication Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006869 lipid transport Biological Process

GO:0006914 autophagy Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007034 vacuolar transport Biological Process

GO:0007041 lysosomal transport Biological Process

GO:0009555 pollen development Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

KEGG gene cross-reference

ath:AT4G02030

ath:AT4G02060

dme:Dmel_CG15087

dosa:Os12g0560700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.422

Rank 1 · TkA06G480290 · TK1151

Cytoplasm0.420

Rank 2 · TkA06G480290 · TK1151

Mitochondrion0.111

Rank 3 · TkA06G480290 · TK1151

Cell membrane0.075

Rank 4 · TkA06G480290 · TK1151

Extracellular0.070

Rank 5 · TkA06G480290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14551MCM_N13-35 aa

PF14551MCM_N31-73 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G480290	`PF14551`	MCM_N	13	35	0.042	15.0
TkA06G480290	`PF14551`	MCM_N	31	73	0.042	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43299`	Arabidopsis thaliana	sp\|P43299\|MCM7_ARATH DNA replication licensing factor MCM7	55.200%	Swiss-Prot	Low
`B8BMI1`	Oryza sativa subsp. indica	sp\|B8BMI1\|MCM7_ORYSI DNA replication licensing factor MCM7	51.700%	Swiss-Prot	Low
`Q2QNM1`	Oryza sativa subsp. japonica	sp\|Q2QNM1\|MCM7_ORYSJ DNA replication licensing factor MCM7	51.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card