TkA06G476060 | RubberDandelionOmics

Gene overview

TkA06G476060

Reference: TK1151 Chr: Chr06 Coordinates: 117971097-117972083 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

951 bp · TkA06G476060|TK1151|cDNA

ATGGTGTTGGACACCGGGAGCGACGTCGTATGGATCCAGTGTTCTCCTTGCCGGAGATGTTACACACAGTCCGATCCCATTTTTGATCCGTCTAAATCAAAGACATTTGGTGGCGTCGCTTGTGGAACCCCTCTGTGTAATCGTCTTGATTCCCCGGGATGCAACCAGCGGAAGAAATGTATGTACCAAGTCTCGTACGGAGACGGATCTTTCACCGTCGGCGAGTTCTCCACGGAAACGCTTACCTTCCGGAAAACCAA...

CDS

Download CDS FASTA

951 bp · TkA06G476060|TK1151|CDS

ATGGTGTTGGACACCGGGAGCGACGTCGTATGGATCCAGTGTTCTCCTTGCCGGAGATGTTACACACAGTCCGATCCCATTTTTGATCCGTCTAAATCAAAGACATTTGGTGGCGTCGCTTGTGGAACCCCTCTGTGTAATCGTCTTGATTCCCCGGGATGCAACCAGCGGAAGAAATGTATGTACCAAGTCTCGTACGGAGACGGATCTTTCACCGTCGGCGAGTTCTCCACGGAAACGCTTACCTTCCGGAAAACCAA...

Protein

Download Protein FASTA

316 aa · TkA06G476060|TK1151|PROTEIN

MVLDTGSDVVWIQCSPCRRCYTQSDPIFDPSKSKTFGGVACGTPLCNRLDSPGCNQRKKCMYQVSYGDGSFTVGEFSTETLTFRKTKVNNIAFGCGHDNEGLFVGAAGLLGLGRGKLSFPNQAGRQFGSKFSYCLVDRSMSAKPSSLVFGNAAVSRVARFTPLLKNPKLDTFYYVGLTGVSVGGLDNSGNGGVIIDSGTSVTRLTRPAYVALRNAFVSGASHLKRGPNFSLFDACFDLSGKTEVKVPTVVMHFAGADVSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G476060`
TK1151 ID	TkA06G476060
OH-1004 ID	LXL04_022566
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 68.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G476060

Location Chr06:117971097-117972083 (-)

Description Similar to APF2: Aspartyl protease family protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01300`	Aspartyl protease.	No verified direct reference in this release
`At3g18490`	Aspartic protease involved in drought avoidance through abscisic acid signaling.	Overexpression of the aspartic protease ASPG1 gene confers drought avoidance in Arabidopsis.2012 · DOI: 10.1093/jxb/err433
`At3g20015`	Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.	No verified direct reference in this release
`At5g10770`	Probably not redundant with AED1 and not involved in restriction of salicylic acid (SA) or systemic acquired resistance (SAR) signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022566 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0070001 aspartic-type peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT3G18490

ath:AT3G20015

ath:AT5G10770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.643

Rank 1 · TkA06G476060 · TK1151

Cell membrane0.112

Rank 2 · TkA06G476060 · TK1151

Endoplasmic reticulum0.095

Rank 3 · TkA06G476060 · TK1151

Lysosome / Vacuole0.079

Rank 4 · TkA06G476060 · TK1151

Cytoplasm0.078

Rank 5 · TkA06G476060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N1-151 aa

PF00026Asp2-311 aa

PF14541TAXi_C173-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G476060	`PF14543`	TAXi_N	1	151	3.8e-48	164.7
TkA06G476060	`PF00026`	Asp	2	311	7.3e-20	72.3
TkA06G476060	`PF14541`	TAXi_C	173	311	1.4e-28	100.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNJ3`	Arabidopsis thaliana	sp\|Q9LNJ3\|APF2_ARATH Aspartyl protease family protein 2	75.700%	Swiss-Prot	High
`Q9LS40`	Arabidopsis thaliana	sp\|Q9LS40\|ASPG1_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 1	56.200%	Swiss-Prot	High
`Q9LHE3`	Arabidopsis thaliana	sp\|Q9LHE3\|ASPG2_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 2	51.700%	Swiss-Prot	High
`Q8S9J6`	Arabidopsis thaliana	sp\|Q8S9J6\|ASPA_ARATH Aspartyl protease family protein At5g10770	42.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card