RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G457380
Reference: TK1151 Chr: Chr06 Coordinates: 113079535-113080410 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

729 bp · TkA06G457380|TK1151|cDNA

ATGTTTAACCGAGGTCATGCATCTTCTGATCGGCGTGGTAGTGCGGGTGGTACTTCGGCTGGTAATTTTCATAGACGTGTGTATTCACCCGAGTCTAGTGGACATGGTAGTTTACATAGACGTTCACACAATAGTACCACTACACCTAGACGACATGGTACTGCTGCTACACCTAGACATGTGACTAGGCCGATAGGGACTGGAGCTGCACGTGCCAACAGTTGGGGTGATTTTGATCCTGTGACTGGCCTTGCTGATTC...

CDS

Download CDS FASTA

729 bp · TkA06G457380|TK1151|CDS

ATGTTTAACCGAGGTCATGCATCTTCTGATCGGCGTGGTAGTGCGGGTGGTACTTCGGCTGGTAATTTTCATAGACGTGTGTATTCACCCGAGTCTAGTGGACATGGTAGTTTACATAGACGTTCACACAATAGTACCACTACACCTAGACGACATGGTACTGCTGCTACACCTAGACATGTGACTAGGCCGATAGGGACTGGAGCTGCACGTGCCAACAGTTGGGGTGATTTTGATCCTGTGACTGGCCTTGCTGATTC...

Protein

Download Protein FASTA

242 aa · TkA06G457380|TK1151|PROTEIN

MFNRGHASSDRRGSAGGTSAGNFHRRVYSPESSGHGSLHRRSHNSTTTPRRHGTAATPRHVTRPIGTGAARANSWGDFDPVTGLADSLPDHGVFRHFTPHGSQMIGGRGGQRADDYYSQLDDHGRELPDDREHNIHTPHYSNAQGTTSGSDVVDFQDSHLPLITLDGMGFADHTIHGYIGALAFESLDHAWPTFTHIPKEVIDEWFARFGTRYRWIPEEAEGIRTNFENILAERFRDRMSGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G457380
TK1151 IDTkA06G457380
OH-1004 IDLXL04_006456
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)97.900
Protein coverage (%)TK1151 100.000 / OH-1004 11.939
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G457380
LocationChr06:113079535-113080410 (-)
DescriptionSimilar to AGO4A: Protein argonaute 4A
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006456 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006417 regulation of translation Biological Process
GO:0009554 megasporogenesis Biological Process
GO:0010526 transposable element silencing Biological Process
GO:0030422 siRNA processing Biological Process
GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process
GO:0031048 regulatory ncRNA-mediated heterochromatin formation Biological Process
GO:0031507 heterochromatin formation Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0048481 plant ovule development Biological Process
GO:0051607 defense response to virus Biological Process
GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process
KEGG gene cross-reference
ath:AT2G27040
ath:AT5G21150
dosa:Os01g0275200
dosa:Os01g0275600
dosa:Os04g0151800
osa:4324438
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962
Rank 1 · TkA06G457380 · TK1151
Cytoplasm0.199
Rank 2 · TkA06G457380 · TK1151
Mitochondrion0.015
Rank 3 · TkA06G457380 · TK1151
Cell membrane0.012
Rank 4 · TkA06G457380 · TK1151
Endoplasmic reticulum0.007
Rank 5 · TkA06G457380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser