TkA06G455470 | RubberDandelionOmics

Gene overview

TkA06G455470

Reference: TK1151 Chr: Chr06 Coordinates: 112614861-112616408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1217 bp · TkA06G455470|TK1151|cDNA

TGTGTCATTCTCATTCAGCATTCATATCCCCTTTAGCTCTATTTTTTCACTTGATAAACACAAACATCATGTCTTCATCAGCCAACAAAAAGTTTGCTCACTTACAGATCCCACTTGAAGAGATACAATCTGCCACCAGAAACTTTTCCAAACAGAATTTCATAAAAAAGGCGGTAATAGGAAACGTTTACAGAGGACAACTGTCAAGGTCCGGACAAAAAATTGATATATTGGCACAGAGGATAGACTGTTCATCTGGA...

CDS

Download CDS FASTA

540 bp · TkA06G455470|TK1151|CDS

ATGTCTTCATCAGCCAACAAAAAGTTTGCTCACTTACAGATCCCACTTGAAGAGATACAATCTGCCACCAGAAACTTTTCCAAACAGAATTTCATAAAAAAGGCGGTAATAGGAAACGTTTACAGAGGACAACTGTCAAGGTCCGGACAAAAAATTGATATATTGGCACAGAGGATAGACTGTTCATCTGGATTCGGAGACATTGAGTTATGGAGGGAGATTCTAACGCTTTCCAGACTCGGGTCACATCGTAATTTGTC...

Protein

Download Protein FASTA

179 aa · TkA06G455470|TK1151|PROTEIN

MSSSANKKFAHLQIPLEEIQSATRNFSKQNFIKKAVIGNVYRGQLSRSGQKIDILAQRIDCSSGFGDIELWREILTLSRLGSHRNLSSVIGFFNEKNEKIIIRKQEANGSLDQCLADPTLTWMRRLRICVGVAQALSYMYYQKGRDFSVIHCDITSSKILLDDQWQPKLSGFEFHLHRP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G455470`
TK1151 ID	TkA06G455470
OH-1004 ID	LXL04_022748
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 98.324 / OH-1004 12.030 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G455470

Location Chr06:112614861-112616408 (-)

Description Similar to At5g59700: Probable receptor-like protein kinase At5g59700

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21230`	Cysteine-rich receptor-like protein kinase 27.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At2g23200`	Probable receptor-like protein kinase At2g23200.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G46290

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkA06G455470 · TK1151

Cell membrane0.401

Rank 2 · TkA06G455470 · TK1151

Nucleus0.304

Rank 3 · TkA06G455470 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA06G455470 · TK1151

Mitochondrion0.030

Rank 5 · TkA06G455470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr32-172 aa

PF00069Pkinase67-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G455470	`PF07714`	PK_Tyr_Ser-Thr	32	172	1.3e-11	45.0
TkA06G455470	`PF00069`	Pkinase	67	172	5.8e-09	36.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49564`	Arabidopsis thaliana	sp\|O49564\|CRK27_ARATH Cysteine-rich receptor-like protein kinase 27	36.400%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	35.400%	Swiss-Prot	Medium
`O22187`	Arabidopsis thaliana	sp\|O22187\|Y2232_ARATH Probable receptor-like protein kinase At2g23200	38.400%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	34.300%	Swiss-Prot	Medium
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	36.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card