TkA06G442800 | RubberDandelionOmics

Gene overview

TkA06G442800

Reference: TK1151 Chr: Chr06 Coordinates: 109417248-109420991 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2718 bp · TkA06G442800|TK1151|cDNA

GGTCGCATTCTAAAACGCAAACACATTTCTCTCTCATACCCAGTGAACACATGACTAAAGTGCGCATTCCACCATGAAAGAAATCAAGAGAGAGAAAGAAGAAAAAAGCAATAAAGCAAGCTCAATAGTCATATGTTGTCATCGTCATAGCAGCAGTTGCCCCTTCTGCATTCCAGACCCACCTTTATGCAGTCTCAGACCACCCCTGTTAAAGACAAATTCACTGGAATCCCCCATTTACACCTTCATAATTCTCTCTC...

CDS

Download CDS FASTA

2061 bp · TkA06G442800|TK1151|CDS

ATGAAAAGGGTTCATGATTCACAGAAGCTTCCCCTTTCAGGCCCGATGCCTGATATTCTCAAAGTACCAAACTCACACTTCAATTTAGTTATAGAAGACATGAATCGAGTAAAACCAGTAACTTTCCAAGATTCCAGATGGAAAGAAAAGAGCTCATTACACAATGACGAAGATCTTATGGTAGATATAACCATGTTGAAAGAAACAGACGATTCTTACGACGAAATCGGTTCCACTTCTTTCTCCGGTGCTAGCCACCC...

Protein

Download Protein FASTA

686 aa · TkA06G442800|TK1151|PROTEIN

MKRVHDSQKLPLSGPMPDILKVPNSHFNLVIEDMNRVKPVTFQDSRWKEKSSLHNDEDLMVDITMLKETDDSYDEIGSTSFSGASHPPEPIDTDLMRPVCVPIGQNNKPMKNGGPFLEDLSICDNLTPSPPFSIPRPSQNPENSPISDEKECVWDASLPPSGNVSPHSSIDSTGVVTSMSTSTYRMSDGMLSIDRNFGNPKTTLRGESLESGKTSISRASDSSGLSDDSNWSNFTGSTNKPHKGNDPRWKAILAIRSRDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G442800`
TK1151 ID	TkA06G442800
OH-1004 ID	LXL04_009954
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.900
Protein coverage (%)	TK1151 64.286 / OH-1004 80.443 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G442800

Location Chr06:109417248-109420991 (-)

Description Similar to D6PKL2: Serine/threonine-protein kinase D6PKL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47750`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
`At4g26610`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
`At5g55910`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	The polarly localized D6 PROTEIN KINASE is required for efficient auxin transport in Arabidopsis thaliana.2009 · DOI: 10.1242/dev.028365 D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484 Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0291600`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release
`UniProt: A2YBX5`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009954 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009630 gravitropism Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048766 root hair initiation Biological Process

GO:2000114 regulation of establishment of cell polarity Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009925 basal plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G26610

ath:AT5G47750

ath:AT5G55910

dosa:Os06g0291600

osa:4340792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · TkA06G442800 · TK1151

Nucleus0.411

Rank 2 · TkA06G442800 · TK1151

Cell membrane0.091

Rank 3 · TkA06G442800 · TK1151

Mitochondrion0.063

Rank 4 · TkA06G442800 · TK1151

Golgi apparatus0.042

Rank 5 · TkA06G442800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase268-418 aa

PF07714PK_Tyr_Ser-Thr269-417 aa

PF03109ABC1328-414 aa

PF00069Pkinase501-604 aa

PF07714PK_Tyr_Ser-Thr508-590 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G442800	`PF00069`	Pkinase	268	418	2.2e-58	198.4
TkA06G442800	`PF07714`	PK_Tyr_Ser-Thr	269	417	1.9e-27	96.9
TkA06G442800	`PF03109`	ABC1	328	414	0.0056	16.6
TkA06G442800	`PF00069`	Pkinase	501	604	2.2e-58	198.4
TkA06G442800	`PF07714`	PK_Tyr_Ser-Thr	508	590	1.9e-27	96.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39183`	Arabidopsis thaliana	sp\|Q39183\|D6KL2_ARATH Serine/threonine-protein kinase D6PKL2	69.100%	Swiss-Prot	High
`Q9SUA3`	Arabidopsis thaliana	sp\|Q9SUA3\|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1	67.100%	Swiss-Prot	Medium
`Q9FG74`	Arabidopsis thaliana	sp\|Q9FG74\|D6PK_ARATH Serine/threonine-protein kinase D6PK	61.300%	Swiss-Prot	High
`Q0DCT8`	Oryza sativa subsp. japonica	sp\|Q0DCT8\|G11A_ORYSJ Protein kinase G11A	66.000%	Swiss-Prot	High
`A2YBX5`	Oryza sativa subsp. indica	sp\|A2YBX5\|G11A_ORYSI Protein kinase G11A	65.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card