TkA06G428570 | RubberDandelionOmics

Gene overview

TkA06G428570

Reference: TK1151 Chr: Chr06 Coordinates: 106014386-106016174 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkA06G428570|TK1151|cDNA

ATGGCAGCGGCGGCCACTACGACGGCGACGGCATCGTATTCCACAATTTCCCCAAAACACCACCTTTCTTTCTCCCCCGATAACCACCACCATCTCAATAAGAACGTTCTAGGTGACAGGAGTTATCCAATTTACATCGGATCTGGTCTTCTTAATCAACCAGACCTTCTACAGAGGCATATTCATGGAAAGAGAGTTCTTGTGGTCACAAACACTACAGTCGCCCCTCTATACCTGGACAAAGTTGTTCACGCATTGAC...

CDS

Download CDS FASTA

963 bp · TkA06G428570|TK1151|CDS

ATGGCAGCGGCGGCCACTACGACGGCGACGGCATCGTATTCCACAATTTCCCCAAAACACCACCTTTCTTTCTCCCCCGATAACCACCACCATCTCAATAAGAACGTTCTAGGTGACAGGAGTTATCCAATTTACATCGGATCTGGTCTTCTTAATCAACCAGACCTTCTACAGAGGCATATTCATGGAAAGAGAGTTCTTGTGGTCACAAACACTACAGTCGCCCCTCTATACCTGGACAAAGTTGTTCACGCATTGAC...

Protein

Download Protein FASTA

320 aa · TkA06G428570|TK1151|PROTEIN

MAAAATTTATASYSTISPKHHLSFSPDNHHHLNKNVLGDRSYPIYIGSGLLNQPDLLQRHIHGKRVLVVTNTTVAPLYLDKVVHALTIGNPNVTVDSVILPDGEKYKNMDTLMKVFDKAIESRLDRRCTFVALGGGVIGDMCGYAAASFLRGVNFIQIPTTVMAQVDSSVGGKTGINHPLGKNMIGAFYQPQCVLIDTDTLNTLPDRELASGLAEVVKYGLIRDATFFEWQEKNMHKLMSRDPDAFAYAIKRSCENKAEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G428570`
TK1151 ID	TkA06G428570
OH-1004 ID	LXL04_022912
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.800
Protein coverage (%)	TK1151 99.688 / OH-1004 83.073 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G428570

Location Chr06:106014386-106016174 (+)

Description Similar to DHQS: 3-dehydroquinate synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66120`	Catalyzes the second step in the shikimate pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022912 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0003856 3-dehydroquinate synthase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G66120

pmy:Pmen_0548

sly:544273

tgr:Tgr7_3030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.540

Rank 1 · TkA06G428570 · TK1151

Cytoplasm0.190

Rank 2 · TkA06G428570 · TK1151

Plastid0.148

Rank 3 · TkA06G428570 · TK1151

Peroxisome0.101

Rank 4 · TkA06G428570 · TK1151

Nucleus0.078

Rank 5 · TkA06G428570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00465Fe-ADH44-162 aa

PF13685Fe-ADH_248-203 aa

PF01761DHQ_synthase98-210 aa

PF24621DHQS_C212-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G428570	`PF00465`	Fe-ADH	44	162	0.00011	22.6
TkA06G428570	`PF13685`	Fe-ADH_2	48	203	9.8e-09	36.1
TkA06G428570	`PF01761`	DHQ_synthase	98	210	2.5e-49	166.4
TkA06G428570	`PF24621`	DHQS_C	212	318	1.5e-42	145.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYV7`	Arabidopsis thaliana	sp\|Q8VYV7\|DHQS_ARATH 3-dehydroquinate synthase, chloroplastic	87.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card