TkA06G418800 | RubberDandelionOmics

Gene overview

TkA06G418800

Reference: TK1151 Chr: Chr06 Coordinates: 103656658-103657846 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1139 bp · TkA06G418800|TK1151|cDNA

ACCACCGCTTCAGTCATCTCACCATACGATCGACCAACGGAACTCAAAGCTTTCGACCAAACAAAATCCGGTGTCAAAGGCCTCGTCGATGCCGGAATCAAAAAAATCCCTCGCATCTTCATCGATCCACCGGCAAGTTCCCCCAAAACCTCCACGACTTTACAGATTCCAGTCATAGACCTCGGATCATCCGATAGAGCATCGACCGTGGAAAAGATCCGTGCGGCCTCGGAGAATTTAGGTTTTTTTCAAGTGGTGAA...

CDS

Download CDS FASTA

1077 bp · TkA06G418800|TK1151|CDS

ACCACCGCTTCAGTCATCTCACCATACGATCGACCAACGGAACTCAAAGCTTTCGACCAAACAAAATCCGGTGTCAAAGGCCTCGTCGATGCCGGAATCAAAAAAATCCCTCGCATCTTCATCGATCCACCGGCAAGTTCCCCCAAAACCTCCACGACTTTACAGATTCCAGTCATAGACCTCGGATCATCCGATAGAGCATCGACCGTGGAAAAGATCCGTGCGGCCTCGGAGAATTTAGGTTTTTTTCAAGTGGTGAA...

Protein

Download Protein FASTA

358 aa · TkA06G418800|TK1151|PROTEIN

TTASVISPYDRPTELKAFDQTKSGVKGLVDAGIKKIPRIFIDPPASSPKTSTTLQIPVIDLGSSDRASTVEKIRAASENLGFFQVVNHGIPVSVMDEVLQGVRRFYEQDVEVKKQFYTRDPSRAVVYNSNFDLFSSPVANWRDTFFSIMAPSPPPPEELPEVCRDIQIEYSNQVLKLGRLLFQLISEALGLKSSHLGDLDCDKGLAFVGHCYPACPQPDLTMGATKHTDDGFITVVLQDEIGGLQILHENQWIDVPPTPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G418800`
TK1151 ID	TkA06G418800
OH-1004 ID	LXL04_022999
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 99.169 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G418800

Location Chr06:103656658-103657846 (+)

Description Similar to At1g06620: 1-aminocyclopropane-1-carboxylate oxidase homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06620`	1-aminocyclopropane-1-carboxylate oxidase homolog 1.	No verified direct reference in this release
`At1g06650`	1-aminocyclopropane-1-carboxylate oxidase homolog 3.	No verified direct reference in this release
`At5g59530`	1-aminocyclopropane-1-carboxylate oxidase homolog 11.	No verified direct reference in this release
`At5g59540`	1-aminocyclopropane-1-carboxylate oxidase homolog 12.	No verified direct reference in this release
`At1g06640`	1-aminocyclopropane-1-carboxylate oxidase homolog 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022999 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016629 12-oxophytodienoate reductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04350

ath:AT1G06620

ath:AT1G06650

ath:AT5G59530

ath:AT5G59540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.855

Rank 1 · TkA06G418800 · TK1151

Nucleus0.294

Rank 2 · TkA06G418800 · TK1151

Endoplasmic reticulum0.053

Rank 3 · TkA06G418800 · TK1151

Cell membrane0.041

Rank 4 · TkA06G418800 · TK1151

Mitochondrion0.040

Rank 5 · TkA06G418800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N56-150 aa

PF031712OG-FeII_Oxy207-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G418800	`PF14226`	DIOX_N	56	150	5.6e-20	72.9
TkA06G418800	`PF03171`	2OG-FeII_Oxy	207	305	1e-29	103.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MB3`	Arabidopsis thaliana	sp\|Q84MB3\|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1	58.000%	Swiss-Prot	High
`Q8H1S4`	Arabidopsis thaliana	sp\|Q8H1S4\|ACCH3_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 3	55.800%	Swiss-Prot	High
`Q9LTH8`	Arabidopsis thaliana	sp\|Q9LTH8\|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11	56.500%	Swiss-Prot	High
`Q9LTH7`	Arabidopsis thaliana	sp\|Q9LTH7\|ACH12_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 12	55.500%	Swiss-Prot	High
`Q9C5K7`	Arabidopsis thaliana	sp\|Q9C5K7\|ACCH2_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 2	53.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card