RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G407300
Reference: TK1151 Chr: Chr06 Coordinates: 100911857-100912651 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

795 bp · TkA06G407300|TK1151|cDNA

ATGCAAGGGTGTCGTAAGGGTGAGACAGTGAAAGGAATTCGTGACCTTAAACTTTATCTTGCTCATTTTGGATACCTAAACTACCAGAAAACCCCAAATGTCATAGATCTTGAAGAAGATCATTTTGAAGAGGACCTTGAGGAAGCCCTCAAGTCGTACCAGGCTTTCTACCATTTGAATGCTACTGGGGTGCTTGACGGGCCCACTGTGTCCCAGATGTTCGTACCTCGGTGCGGGTGTCCCGATAAAGATATTCACAA...

CDS

Download CDS FASTA

795 bp · TkA06G407300|TK1151|CDS

ATGCAAGGGTGTCGTAAGGGTGAGACAGTGAAAGGAATTCGTGACCTTAAACTTTATCTTGCTCATTTTGGATACCTAAACTACCAGAAAACCCCAAATGTCATAGATCTTGAAGAAGATCATTTTGAAGAGGACCTTGAGGAAGCCCTCAAGTCGTACCAGGCTTTCTACCATTTGAATGCTACTGGGGTGCTTGACGGGCCCACTGTGTCCCAGATGTTCGTACCTCGGTGCGGGTGTCCCGATAAAGATATTCACAA...

Protein

Download Protein FASTA

264 aa · TkA06G407300|TK1151|PROTEIN

MQGCRKGETVKGIRDLKLYLAHFGYLNYQKTPNVIDLEEDHFEEDLEEALKSYQAFYHLNATGVLDGPTVSQMFVPRCGCPDKDIHKNTDNSLHNDTASLYRLYPNREKWPSDKMQLTYGFGPGYPTQFKPPVDRAFGKWASAFPYLTFSRAESYEGADLTISFEAGNHGDGKANAFDGRGGVLAHAFAPTDGRLHFDAAEAWVVGAVPNCHDIETTALHEIGHLLGLAHSQVPDSIMWPTITTGVTKGLNSDDIQGLSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G407300
TK1151 IDTkA06G407300
OH-1004 IDLXL04_023059
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 86.557
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G407300
LocationChr06:100911857-100912651 (+)
DescriptionSimilar to 2MMP: Metalloendoproteinase 2-MMP
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g70170 Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity). No verified direct reference in this release
At1g59970 Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity). No verified direct reference in this release
At1g24140 Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity). No verified direct reference in this release
At2g45040 Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_023059 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0030198 extracellular matrix organization Biological Process
GO:0030574 collagen catabolic process Biological Process
GO:0046686 response to cadmium ion Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0080186 developmental vegetative growth Biological Process
GO:1900056 negative regulation of leaf senescence Biological Process
GO:2000028 regulation of photoperiodism, flowering Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G24140
ath:AT1G59970
ath:AT1G70170
ath:AT2G45040
gmx:547880
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.413
Rank 1 · TkA06G407300 · TK1151
Lysosome / Vacuole0.227
Rank 2 · TkA06G407300 · TK1151
Cytoplasm0.190
Rank 3 · TkA06G407300 · TK1151
Endoplasmic reticulum0.105
Rank 4 · TkA06G407300 · TK1151
Cell membrane0.064
Rank 5 · TkA06G407300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01471PG_binding_112-73 aa
PF13582Reprolysin_316-48 aa
PF00413Peptidase_M1026-60 aa
PF30262PGDB_FadG-YbfG38-73 aa
PF01400Astacin107-142 aa
PF00413Peptidase_M10116-263 aa
PF12388Peptidase_M57178-232 aa
PF13582Reprolysin_3206-231 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G407300PF01471PG_binding_112734.7e-1040.2
TkA06G407300PF13582Reprolysin_316480.006417.7
TkA06G407300PF00413Peptidase_M1026602e-40139.0
TkA06G407300PF30262PGDB_FadG-YbfG38730.04414.5
TkA06G407300PF01400Astacin1071420.05313.9
TkA06G407300PF00413Peptidase_M101162632e-40139.0
TkA06G407300PF12388Peptidase_M571782320.4111.0
TkA06G407300PF13582Reprolysin_32062310.006417.7
TkA06G407300PF01400Astacin2092320.05313.9
TkA06G407300PF13583Reprolysin_42112330.06313.6
TkA06G407300PF06262Zincin_12122310.2312.1
TkA06G407300PF16313DUF49532152310.1412.1
TkA06G407300PF12044Metallopep2182380.01614.5
TkA06G407300PF07998Peptidase_M542182400.06414.0
TkA06G407300PF12388Peptidase_M572352620.4111.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O04529Arabidopsis thalianasp|O04529|2MMP_ARATH Metalloendoproteinase 2-MMP40.100%Swiss-ProtMedium
Q9ZUJ5Arabidopsis thalianasp|Q9ZUJ5|5MMP_ARATH Metalloendoproteinase 5-MMP40.200%Swiss-ProtMedium
Q5XF51Arabidopsis thalianasp|Q5XF51|3MMP_ARATH Metalloendoproteinase 3-MMP37.800%Swiss-ProtMedium
Q8GWW6Arabidopsis thalianasp|Q8GWW6|4MMP_ARATH Metalloendoproteinase 4-MMP41.100%Swiss-ProtMedium

JBrowse

View in Genome Browser