TkA06G391510 | RubberDandelionOmics

Gene overview

TkA06G391510

Reference: TK1151 Chr: Chr06 Coordinates: 97068277-97070613 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1129 bp · TkA06G391510|TK1151|cDNA

TTTGTAACACACGGAGGGGCAATTTCGGTAGTCTCTTGGGTATTATTTTGAACTGTTCCTAATTTTAGGGATGAAAATTTGGAAAGTTGAAGTTGCCGTTCCCTTGTGTTCATATCCCTCTCTCCTTTTCTTTCTCTCGACAGCTCCATCGAACCCTAACCCTATCCTTACCATTGTCCACCGCCGTGTCACCTTGCCCCGTCGCCTTCAGCCGCTGCTCCCATCCGCAACACCTCTCGACAGCCACCAGTATGTTTACC...

CDS

Download CDS FASTA

480 bp · TkA06G391510|TK1151|CDS

ATGATGTATTTCTTACAGAATTTAGAAGATTCATTAGAAGTTCTTGTGATTAGTGCACAAAGAAAAGGCAAAGGGATGTTGTTCCCTAAGGGAGGTTGGGAATCCGATGAATCCATAAAAGAAGCTGCTCTAAGAGAATCCTTAGAAGAAGCCGGAGTATTAGGAACTATTGAGTTTATAGAAGAAGAAGTCAAAGACAGACAAGGATATCTTGCATCATTTGAAGATTTGTACAAGGAAATTCTTCAAGCAATGTTGAA...

Protein

Download Protein FASTA

159 aa · TkA06G391510|TK1151|PROTEIN

MMYFLQNLEDSLEVLVISAQRKGKGMLFPKGGWESDESIKEAALRESLEEAGVLGTIEFIEEEVKDRQGYLASFEDLYKEILQAMLKLDAKISEANEKFPNNLKISEWRPRFDGFFGISSSMDFFWDFLIITYVLITNDLNIYHIPSFISCHNLCVNDY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G391510`
TK1151 ID	TkA06G391510
OH-1004 ID	LXL04_022903
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.200
Protein coverage (%)	TK1151 91.824 / OH-1004 91.824 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G391510

Location Chr06:97068277-97070613 (+)

Description Similar to NUDT21: Nudix hydrolase 21, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73540`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At1g18300`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At1g14860`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At2g01670`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At3g12600`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022903 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015959 diadenosine polyphosphate metabolic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030643 intracellular phosphate ion homeostasis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0071543 diphosphoinositol polyphosphate metabolic process Biological Process

GO:0071545 inositol phosphate catabolic process Biological Process

GO:1901907 diadenosine pentaphosphate catabolic process Biological Process

GO:1901909 diadenosine hexaphosphate catabolic process Biological Process

GO:1901911 adenosine 5'-(hexahydrogen pentaphosphate) catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G14860

ath:AT1G18300

ath:AT1G73540

ath:AT2G01670

spo:2542890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · TkA06G391510 · TK1151

Nucleus0.274

Rank 2 · TkA06G391510 · TK1151

Mitochondrion0.151

Rank 3 · TkA06G391510 · TK1151

Endoplasmic reticulum0.102

Rank 4 · TkA06G391510 · TK1151

Peroxisome0.101

Rank 5 · TkA06G391510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00293NUDIX13-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G391510	`PF00293`	NUDIX	13	71	2.9e-09	37.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY81`	Arabidopsis thaliana	sp\|Q8VY81\|NUD21_ARATH Nudix hydrolase 21, chloroplastic	76.600%	Swiss-Prot	Low
`Q9LE73`	Arabidopsis thaliana	sp\|Q9LE73\|NUDT4_ARATH Nudix hydrolase 4	72.300%	Swiss-Prot	Low
`Q9LQU5`	Arabidopsis thaliana	sp\|Q9LQU5\|NUD18_ARATH Nudix hydrolase 18, mitochondrial	66.700%	Swiss-Prot	Low
`Q9ZU95`	Arabidopsis thaliana	sp\|Q9ZU95\|NUD17_ARATH Nudix hydrolase 17, mitochondrial	66.700%	Swiss-Prot	Low
`Q9LHK1`	Arabidopsis thaliana	sp\|Q9LHK1\|NUD16_ARATH Nudix hydrolase 16, mitochondrial	58.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card