TkA06G386690 | RubberDandelionOmics

Gene overview

TkA06G386690

Reference: TK1151 Chr: Chr06 Coordinates: 95663981-95664971 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

817 bp · TkA06G386690|TK1151|cDNA

CAAGCTTCCTCTTTAATAGCGTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTAACCTACCCCCACCCGACTCTGCATTTTTACTCTCTGTTTCTTTCTTATTTTCACCACAAAGACGTTTACAAAAAACAATCAACAATGCAAAAGAACAAGCTCAACGAACTGTGCCAGAAGAATGGCTGGCGAACCCCAACGTATACCTGCATCAAAGAAGGCCAAGACCACTGCCCACTCTTCAAAGCTTCAGTTGTCGTTA...

CDS

Download CDS FASTA

468 bp · TkA06G386690|TK1151|CDS

ATGCAAAAGAACAAGCTCAACGAACTGTGCCAGAAGAATGGCTGGCGAACCCCAACGTATACCTGCATCAAAGAAGGCCAAGACCACTGCCCACTCTTCAAAGCTTCAGTTGTCGTTAATGGCGCCACTTTTGCTTCACAATCCATCTCCAAATCCTCCAAATCGGCACAAAATGATGCCGCAACACTCGCTCTCTCTCAGCTCACAGCTTCTCGTGAGGTATGCAATACAATCGAGGTTTGTTTACCCGTTGATTTACC...

Protein

Download Protein FASTA

155 aa · TkA06G386690|TK1151|PROTEIN

MQKNKLNELCQKNGWRTPTYTCIKEGQDHCPLFKASVVVNGATFASQSISKSSKSAQNDAATLALSQLTASREVCNTIEVCLPVDLPEEKVVTTTYSSHSHTTVSIGEPNLEKSMKSYLLCNKVRVYTSIPDKMLPMGTVMLPIGEDKWTVASLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G386690`
TK1151 ID	TkA06G386690
OH-1004 ID	LXL04_004493
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.700
Protein coverage (%)	TK1151 45.161 / OH-1004 20.290 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G386690

Location Chr06:95663981-95664971 (-)

Description Similar to DRB2: Double-stranded RNA-binding protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28380`	Binds double-stranded RNA.	Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-004-6853-5
`At5g41070`	Binds double-stranded RNA.	Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-004-6853-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0480500`	Binds double-stranded RNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004493 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0035196 miRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003725 double-stranded RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G28380

ath:AT3G26932

ath:AT5G41070

dosa:Os05g0150400

dosa:Os10g0480500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.704

Rank 1 · TkA06G386690 · TK1151

Cytoplasm0.387

Rank 2 · TkA06G386690 · TK1151

Cell membrane0.057

Rank 3 · TkA06G386690 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA06G386690 · TK1151

Mitochondrion0.032

Rank 5 · TkA06G386690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00035dsrm3-68 aa

PF14709DND1_DSRM3-68 aa

PF04098Rad52_Rad224-22 aa

PF24385DSRM_DHX296-39 aa

PF04098Rad52_Rad2244-68 aa

PF14709DND1_DSRM108-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G386690	`PF00035`	dsrm	3	68	9e-16	58.9
TkA06G386690	`PF14709`	DND1_DSRM	3	68	1.3e-08	35.8
TkA06G386690	`PF04098`	Rad52_Rad22	4	22	0.26	11.9
TkA06G386690	`PF24385`	DSRM_DHX29	6	39	0.0016	19.2
TkA06G386690	`PF04098`	Rad52_Rad22	44	68	0.26	11.9
TkA06G386690	`PF14709`	DND1_DSRM	108	117	1.3e-08	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKN2`	Arabidopsis thaliana	sp\|Q9SKN2\|DRB2_ARATH Double-stranded RNA-binding protein 2	44.900%	Swiss-Prot	Low
`Q8GY79`	Arabidopsis thaliana	sp\|Q8GY79\|DRB5_ARATH Double-stranded RNA-binding protein 5	44.300%	Swiss-Prot	Low
`Q9AV50`	Oryza sativa subsp. japonica	sp\|Q9AV50\|DRB6_ORYSJ Double-stranded RNA-binding protein 6	44.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card