TkA06G348950 | RubberDandelionOmics

Gene overview

TkA06G348950

Reference: TK1151 Chr: Chr06 Coordinates: 86702935-86703966 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

828 bp · TkA06G348950|TK1151|cDNA

ATGGCGTTTATTGTTGGAGAAAGAGTTGAATTTGCTAGCGTTGAACCTGGATTTACCAGAGCCACATACGGTGGAAGGGTTCTTGGAATAGGTGATGGTGTTGTGGATGTGGCTCACGACCATGCTATGGCAGCAGATGGATATCCATCTGTAGAGTCTGTTGCCATTGAGCGAGTGAAGCCATTTCCGGAGCAATTTCAGATGCCTATTCACACTGGAGATGTGGTAGACGTATGGCTGTCTGGCTCCTGGTGGACTGG...

CDS

Download CDS FASTA

828 bp · TkA06G348950|TK1151|CDS

ATGGCGTTTATTGTTGGAGAAAGAGTTGAATTTGCTAGCGTTGAACCTGGATTTACCAGAGCCACATACGGTGGAAGGGTTCTTGGAATAGGTGATGGTGTTGTGGATGTGGCTCACGACCATGCTATGGCAGCAGATGGATATCCATCTGTAGAGTCTGTTGCCATTGAGCGAGTGAAGCCATTTCCGGAGCAATTTCAGATGCCTATTCACACTGGAGATGTGGTAGACGTATGGCTGTCTGGCTCCTGGTGGACTGG...

Protein

Download Protein FASTA

275 aa · TkA06G348950|TK1151|PROTEIN

MAFIVGERVEFASVEPGFTRATYGGRVLGIGDGVVDVAHDHAMAADGYPSVESVAIERVKPFPEQFQMPIHTGDVVDVWLSGSWWTGECVGEDQNEWVVFFDFKPFAVSRCKHSKVIVRKHQDCIIGANISHWSIWPSFSVGSRVEVLGLKPHYDSAFVGGRIRRFCPDGVDVQYETIRAVNRRKFVTFVPHGRIRPYPLSWIGNYRPGDMLDAWDGYAWWPGLCVRMEHDRYVISFHHRFAYGTEVPVNKPDLRRSQLW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G348950`
TK1151 ID	TkA06G348950
OH-1004 ID	LXL04_038329
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	87.200
Protein coverage (%)	TK1151 92.000 / OH-1004 39.357 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G348950`
Location	Chr06:86702935-86703966 (-)
Description	Similar to AGDP1: Protein AGENET DOMAIN (AGD)-CONTAINING P1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038329` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0000775 chromosome, centromeric region Cellular Component GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0042393 histone binding Molecular Function GO:0140566 histone reader activity Molecular Function
KEGG gene cross-reference	ath:AT1G09320 ath:AT2G47230 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.639

Rank 1 · TkA06G348950 · TK1151

Cytoplasm0.493

Rank 2 · TkA06G348950 · TK1151

Endoplasmic reticulum0.043

Rank 3 · TkA06G348950 · TK1151

Cell membrane0.033

Rank 4 · TkA06G348950 · TK1151

Mitochondrion0.028

Rank 5 · TkA06G348950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641Agenet6-63 aa

PF17295DUF534869-101 aa

PF05641Agenet73-102 aa

PF17295DUF5348138-148 aa

PF05641Agenet142-199 aa

PF17295DUF5348207-239 aa

PF05641Agenet217-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G348950	`PF05641`	Agenet	6	63	7.3e-08	33.5
TkA06G348950	`PF17295`	DUF5348	69	101	0.15	12.7
TkA06G348950	`PF05641`	Agenet	73	102	7.3e-08	33.5
TkA06G348950	`PF17295`	DUF5348	138	148	0.15	12.7
TkA06G348950	`PF05641`	Agenet	142	199	7.3e-08	33.5
TkA06G348950	`PF17295`	DUF5348	207	239	0.15	12.7
TkA06G348950	`PF05641`	Agenet	217	239	7.3e-08	33.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card