TkA06G347560 | RubberDandelionOmics

Gene overview

TkA06G347560

Reference: TK1151 Chr: Chr06 Coordinates: 86348281-86353287 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2170 bp · TkA06G347560|TK1151|cDNA

GGAAAAGGATAAAACCATTTGTGGTTTTTAAAAACCTAAGCCTACCAAAAACCGGCAAAACTAAAGCCTGAGTTCGTATTTTGGTTATGCAAACTTACGCCATCTGTTTCACATTTCTAGAAGTAGAACAGCCTCCTATCAATTTTCAATCTTTTAATAATCAACGTATTTGTGAGATCTCGACTATTTGAAACTTCCACTATTTTATGCCCGTGTCATCAAGCTTTTCCCAAATTATAATATTGACAGCATCAAGCACG...

CDS

Download CDS FASTA

1110 bp · TkA06G347560|TK1151|CDS

ATGGATAATAATATCAGTTGTGAGATGAAAGTTGAAACGGGAGACGCAGGTTATGTGCTTGAAGACGTGCCTCACTTGAGTGATTACATCCCTGATCTCCCCACTTATCCCAATCCACTGCGATCCAATCCTGCATATTCAGTTGTGAAACAGTACTTTGTGGATGCCGATGACACTGTTCCTCAAAAGGTTGTTGTCCATAAAGATGGTCCAAGAGGGATACATTTTAGACGTGCTGGACCCCGCCAAAGGGTTTATTT...

Protein

Download Protein FASTA

369 aa · TkA06G347560|TK1151|PROTEIN

MDNNISCEMKVETGDAGYVLEDVPHLSDYIPDLPTYPNPLRSNPAYSVVKQYFVDADDTVPQKVVVHKDGPRGIHFRRAGPRQRVYFTPDEVHAAIVTCGGLCPGLNTVIREIVCALYHMYGVTKVLGIDGGYRGFYSKNTITLTPKVVNDIHKRGGTIIGTSRGGHDKPKIVDSIQDRGINQVYIIGGDGTQKGAAVIYQEVRRRGLKAVVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G347560`
TK1151 ID	TkA06G347560
OH-1004 ID	LXL04_023382
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.290 / OH-1004 74.481 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G347560

Location Chr06:86348281-86353287 (-)

Description Similar to PFK3: ATP-dependent 6-phosphofructokinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26270`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At5g56630`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At4g32840`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At4g29220`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At5g61580`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023382 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003872 6-phosphofructokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G26270

ath:AT4G29220

ath:AT4G32840

ath:AT5G56630

ath:AT5G61580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.686

Rank 1 · TkA06G347560 · TK1151

Nucleus0.313

Rank 2 · TkA06G347560 · TK1151

Mitochondrion0.134

Rank 3 · TkA06G347560 · TK1151

Cell membrane0.060

Rank 4 · TkA06G347560 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA06G347560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00365PFK94-331 aa

PF01513NAD_kinase124-152 aa

PF00781DAGK_cat146-223 aa

PF01513NAD_kinase171-202 aa

PF00781DAGK_cat301-322 aa

PF01513NAD_kinase303-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G347560	`PF00365`	PFK	94	331	6.5e-60	203.5
TkA06G347560	`PF01513`	NAD_kinase	124	152	0.21	12.6
TkA06G347560	`PF00781`	DAGK_cat	146	223	0.017	15.5
TkA06G347560	`PF01513`	NAD_kinase	171	202	0.21	12.6
TkA06G347560	`PF00781`	DAGK_cat	301	322	0.017	15.5
TkA06G347560	`PF01513`	NAD_kinase	303	332	0.21	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AA4`	Arabidopsis thaliana	sp\|Q94AA4\|PFKA3_ARATH ATP-dependent 6-phosphofructokinase 3	81.900%	Swiss-Prot	High
`Q9C5J7`	Arabidopsis thaliana	sp\|Q9C5J7\|PFKA7_ARATH ATP-dependent 6-phosphofructokinase 7	80.200%	Swiss-Prot	High
`Q9M076`	Arabidopsis thaliana	sp\|Q9M076\|PFKA6_ARATH ATP-dependent 6-phosphofructokinase 6	79.100%	Swiss-Prot	High
`Q9M0F9`	Arabidopsis thaliana	sp\|Q9M0F9\|PFKA1_ARATH ATP-dependent 6-phosphofructokinase 1	77.500%	Swiss-Prot	High
`Q9FKG3`	Arabidopsis thaliana	sp\|Q9FKG3\|PFKA4_ARATH ATP-dependent 6-phosphofructokinase 4, chloroplastic	73.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card